DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GstE4

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:226 Identity:54/226 - (23%)
Similarity:85/226 - (37%) Gaps:71/226 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVS---PLLKVPALQLVAEKGE 81
            |.:.||.:...|..:...|.|.|.::|:..|::||.||..:..:.|   |...||.||    ..:
  Fly     2 GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQ----DDD 62

  Fly    82 PSLIESLIIAEYLDDKY-PENPLLPKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYWTAL 145
            ..:.:|..|..||.:|| |.:.|.|||.|:||:...|:...|.:                     
  Fly    63 ACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGV--------------------- 106

  Fly   146 DIFEEELTKRGTP--YFG------------------------------GNKPGFVDYMIWPWFER 178
             |||..|.:...|  :||                              |::....|:.|......
  Fly   107 -IFESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITS 170

  Fly   179 LSV-IELKLQKEYNFNESRFPKITKWIALLK 208
            :.| :||        :.:::|||..|:..||
  Fly   171 IGVFLEL--------DPAKYPKIAAWLERLK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 22/77 (29%)
GstA 22..209 CDD:223698 53/224 (24%)
GST_C_Omega 109..230 CDD:198293 24/133 (18%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/76 (29%)
GstA 6..196 CDD:223698 53/222 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/133 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.