DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GstE2

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:229 Identity:58/229 - (25%)
Similarity:91/229 - (39%) Gaps:61/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEW---LVEVSPLLKVPALQLVAEKGEPS 83
            |.||.|...|..:...|.|.|.|:.|....::|.....:   .::.:|...||.|:   :.|  :
  Fly     5 LVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLE---DNG--A 64

  Fly    84 LI-ESLIIAEYLDDKYP-ENPLLPKDPLKRAQ-------DKILLERFSSITSAFINILVQGTGL- 138
            || :|..|..||.|||. .:.|.|:|.:.|||       |..:|  |.|:.:..|...::...| 
  Fly    65 LIWDSHAIVCYLVDKYANSDELYPRDLVLRAQVDQRLFFDASIL--FMSLRNVSIPYFLRQVSLV 127

  Fly   139 --------EDYWTALDIFEEELTKRGTPYFGGNKPGF-----------------VDYMIWP---- 174
                    :|.:..|:.|..:     .||..|::...                 :|.:.:|    
  Fly   128 PKEKVDNIKDAYGHLENFLGD-----NPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAA 187

  Fly   175 WFERLSVIELKLQKEYNFNESRFPKITKWIALLK 208
            ||||||       |..::.|.....:.|:|.|||
  Fly   188 WFERLS-------KLPHYEEDNLRGLKKYINLLK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 21/76 (28%)
GstA 22..209 CDD:223698 58/229 (25%)
GST_C_Omega 109..230 CDD:198293 30/137 (22%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 52/209 (25%)
GST_N_Delta_Epsilon 5..78 CDD:239343 22/77 (29%)
GST_C_Delta_Epsilon 94..209 CDD:198287 25/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.