DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GstT1

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:240 Identity:60/240 - (25%)
Similarity:95/240 - (39%) Gaps:48/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YSMRFCPYAQRA-HLVLNAKNVPYHSVYINLTEKPEWLVE----VSPLLKVPALQLVAEKGEPSL 84
            |...|.....|| .:.:.....|:....:.| .|.|.|.:    ::...||||:    ..|:..|
  Fly     7 YYYDFLSQPSRALWIAMKLGKTPFEDCPVAL-RKQEQLTDEYRSINRFQKVPAI----VDGKFQL 66

  Fly    85 IESLIIAEYLDDK--YPENPLLPKDPLKRAQDKILLE----RFSSITSAFIN--ILVQGTGL--- 138
            .||:.|..||.||  :.|. |.||...:||:....||    ....:.|.|..  .|:...||   
  Fly    67 GESVSIVRYLADKGVFSEQ-LYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPA 130

  Fly   139 ----------EDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFN 193
                      :|..:.|.:.|....::  .:..|:|....|.     |....:.::|| .:||.|
  Fly   131 PKPESVKKLIKDVESNLGLLERLWLEK--DFLVGDKLTVADI-----FGSSEINQMKL-CQYNVN 187

  Fly   194 ESRFPKITKWIALLKADSVVQSFYATPEQHNEFWRTR----KAGN 234
            |.:|||:.||:..::  .....:|  .|.|:..::|.    ||.|
  Fly   188 EKQFPKVAKWMERVR--DATNPYY--DEAHSFVYKTSQQAVKAKN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 19/74 (26%)
GstA 22..209 CDD:223698 53/209 (25%)
GST_C_Omega 109..230 CDD:198293 30/139 (22%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 53/212 (25%)
GST_N_Theta 5..80 CDD:239348 21/77 (27%)
GST_C_Theta 93..218 CDD:198292 30/136 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460038
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.