DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and gsto-2

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_871705.3 Gene:gsto-2 / 353420 WormBaseID:WBGene00015337 Length:254 Species:Caenorhabditis elegans


Alignment Length:250 Identity:88/250 - (35%)
Similarity:135/250 - (54%) Gaps:24/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLK 69
            |.:..|.|.|..|..|.:|:|:||:||:||||.:..:.|.:|...:.|:|.:||:|........:
 Worm    10 KVVKNGDPAPAPPASGTIRIYNMRYCPWAQRALIFASLKKIPTEVINIHLDQKPDWFFTKHYKGQ 74

  Fly    70 VPALQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFS-SITSAFINILV 133
            ||||:  .::|:..:|||.:|.|||||.|||..::|.|..::.|.|:||:|.| .::|||..: |
 Worm    75 VPALE--HDEGKKIVIESAVIPEYLDDIYPEPRIIPTDHYEKVQQKLLLDRISGQLSSAFYGV-V 136

  Fly   134 QGTGLEDYW--------TALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFER-------LSVIE 183
            |...:.|..        .|.|..||.||  |..|.|.:|||||||:|:|..:|       :....
 Worm   137 QAAKISDLLKEKLVELAKAYDTAEELLT--GDFYSGTSKPGFVDYLIYPNIQRAFWTSHIIKDFP 199

  Fly   184 LKLQKEYNFNESRFPKITKWIALLKADSVVQSFYATPEQHNEFWRTRKAGNANYD 238
            ||::   :|....:||::||...|.:...|.:.....|...||:::...|..|:|
 Worm   200 LKVE---SFPGPNYPKLSKWYKRLDSIPEVIATSQPTETAVEFFKSWIIGAPNFD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 34/89 (38%)
GstA 22..209 CDD:223698 75/202 (37%)
GST_C_Omega 109..230 CDD:198293 43/136 (32%)
gsto-2NP_871705.3 Thioredoxin_like 8..98 CDD:294274 34/89 (38%)
GstA 29..224 CDD:223698 74/202 (37%)
GST_C_family 112..242 CDD:295467 43/135 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159280
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37971
Inparanoid 1 1.050 141 1.000 Inparanoid score I3065
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm4834
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X130
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.750

Return to query results.
Submit another query.