DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GstT3

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:227 Identity:49/227 - (21%)
Similarity:88/227 - (38%) Gaps:61/227 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LVLNAKNVPYHSVYI------NLTEKPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLD- 95
            ::....|:|:....:      :|||  ::..|::...:||.:.   :.|. .|.||:.|..||. 
  Fly    61 IIFRLSNMPFEDCVVALRNGEHLTE--DFKKEINRFQRVPCIH---DNGY-KLAESVAILRYLSA 119

  Fly    96 -DKYPENPLLPKDPLKRAQ-DKILLERFSS--ITSA--FINILVQG--TGLEDYWTALDIFE--- 149
             .|.||: |.||..:.::: |:.|..:..|  :|.|  |..:.::.  ||.......::.|.   
  Fly   120 KGKIPEH-LYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQM 183

  Fly   150 -------EELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPKITKWIALL 207
                   ||:...|..:..|:.....|  |:...|    ||.....:|:. ..::|||..|:.  
  Fly   184 ERNLDVVEEVWLEGKDFLTGSSLTVAD--IFAACE----IEQTRMADYDV-RIKYPKIRAWLK-- 239

  Fly   208 KADSVVQSFYATPEQHNEFWRTRKAGNANYDL 239
                                |.|::.|..||:
  Fly   240 --------------------RVRQSCNPYYDV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 14/62 (23%)
GstA 22..209 CDD:223698 44/195 (23%)
GST_C_Omega 109..230 CDD:198293 24/137 (18%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 15/65 (23%)
GstA 47..243 CDD:223698 45/217 (21%)
GST_C_Theta 135..259 CDD:198292 28/146 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.