DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and Clic

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:170 Identity:33/170 - (19%)
Similarity:55/170 - (32%) Gaps:69/170 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVP--YHSVYINLTEKPEWLVEVSPLLKVPALQLV 76
            |:|.|:|:..|.:.:.     ..|::   ||:|  |     ||                    .|
  Fly    85 PILIDNGLAILENEKI-----ERHIM---KNIPGGY-----NL--------------------FV 116

  Fly    77 AEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDY 141
            .:|...:|||:|.:...|       .|:.||   .|::..||.....|                 
  Fly   117 QDKEVATLIENLYVKLKL-------MLVKKD---EAKNNALLSHLRKI----------------- 154

  Fly   142 WTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSV 181
                   .:.|:.|.|.:..|:.....|..:.|..:.:.|
  Fly   155 -------NDHLSARNTRFLTGDTMCCFDCELMPRLQHIRV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 18/82 (22%)
GstA 22..209 CDD:223698 29/162 (18%)
GST_C_Omega 109..230 CDD:198293 11/73 (15%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 9/34 (26%)
O-ClC 21..231 CDD:129941 33/170 (19%)
GST_C_CLIC 118..232 CDD:198307 20/104 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.