DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTT2

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_000845.2 Gene:GSTT2 / 2953 HGNCID:4642 Length:244 Species:Homo sapiens


Alignment Length:199 Identity:46/199 - (23%)
Similarity:79/199 - (39%) Gaps:38/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RAHLVLNAKN-VPYHSVYINLTE---KPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLD 95
            ||..:...|| :|.....::|.:   |.:..::::.|.|:|.|    :.|:..|.||..|..||.
Human    15 RAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTL----KDGDFILTESSAILIYLS 75

  Fly    96 DKY--PENPLLPKDPLKRAQ---------DKIL----LERFSSITSAFINILVQGTGLEDYWTAL 145
            .||  |:: ..|.|...||:         |.|.    :..:..:....|.:.|....:|...||:
Human    76 CKYQTPDH-WYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAM 139

  Fly   146 D-----IFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPKITKWIA 205
            |     :.::.|..|  |:..|.:....|.|      .|..:...:...|...|.| |::..|..
Human   140 DQALQWLEDKFLGDR--PFLAGQQVTLADLM------ALEELMQPVALGYELFEGR-PRLAAWRG 195

  Fly   206 LLKA 209
            .::|
Human   196 RVEA 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 17/63 (27%)
GstA 22..209 CDD:223698 45/197 (23%)
GST_C_Omega 109..230 CDD:198293 23/119 (19%)
GSTT2NP_000845.2 GST_N_Theta 3..78 CDD:239348 18/66 (27%)
GstA 14..210 CDD:223698 46/199 (23%)