DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and GSTT4

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:209 Identity:42/209 - (20%)
Similarity:83/209 - (39%) Gaps:44/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTE---KPEWLVEVSPLLKVPALQLVAEKGEPS 83
            |.||........:..::.....::.::..:::|.:   ..:..::::||.|:|:|    :.|:..
Human     3 LELYMDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSL----KDGKFI 63

  Fly    84 LIESLIIAEYLDDKY--PENPLLPKDPLKRAQD---------------------KILLERFSSIT 125
            |.||..|..||..||  |.: ..|.||..||:.                     |:|:.:   ||
Human    64 LSESAAILYYLCRKYSAPSH-WCPPDPHARARVDEFVAWQHTAFQLPMKKIVWLKLLIPK---IT 124

  Fly   126 SAFINILVQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEY 190
            ...::.......:|:...:|.:|||... :...:..||:....|.        ::|:|:......
Human   125 GEEVSAEKMEHAVEEVKNSLQLFEEYFL-QDKMFITGNQISLADL--------VAVVEMMQPMAA 180

  Fly   191 NFNE-SRFPKITKW 203
            |:|. ....|:.:|
Human   181 NYNVFLNSSKLAEW 194

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 15/75 (20%)
GstA 22..209 CDD:223698 42/209 (20%)
GST_C_Omega 109..230 CDD:198293 20/117 (17%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 16/78 (21%)