DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and gst1

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:247 Identity:53/247 - (21%)
Similarity:86/247 - (34%) Gaps:64/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LYSMRFCPYAQRAHLVLNAKNVPYHSVYINLT----EKPEWLVEVSPLLKVPALQLVAEKGEPSL 84
            |:|....|...:....|...::.|.:.|:|.:    :.||.|. ::|..:||.| :.....:.::
pombe     6 LWSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPEHLA-LNPNGRVPTL-IDHHNNDYTI 68

  Fly    85 IESLIIAEYLDDKY-PENPL-LPKD-PLKRAQDKILLERFSSITSAFINILVQGTGLEDYW---- 142
            .||..|..||.||| .|..: ||:| |          |.:..|...|.    |.:|....|    
pombe    69 WESDAILIYLADKYDTERKISLPRDHP----------EYYKVIQYLFF----QASGQGIIWGQAG 119

  Fly   143 -----------TALDIFEEELTK---------RGTPYFGGNKPGFVDYMIWPWFERLSVI----E 183
                       :|:..:..|:.:         :...|...|:....|.....|...|.:|    :
pombe   120 WFSVYHQELVISAITRYRNEIKRVLGVLEDILKDRDYLVANRFTIADLSFISWNNFLEIIFAEGK 184

  Fly   184 LKLQKE---YNFNESRFPKITKWIALLKADSVVQSFYATPEQHNEFWRTRKA 232
            ..:::|   .:| |..||:...|         .|...|.|.....|....||
pombe   185 FSIEEEVPQLDF-EKEFPRTYSW---------HQRLLARPASKATFEERSKA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 18/74 (24%)
GstA 22..209 CDD:223698 47/222 (21%)
GST_C_Omega 109..230 CDD:198293 24/151 (16%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 22/79 (28%)
GstA 5..218 CDD:223698 50/237 (21%)
GST_C_Ure2p 96..219 CDD:198326 23/136 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.