Sequence 1: | NP_648234.1 | Gene: | GstO3 / 38972 | FlyBaseID: | FBgn0035904 | Length: | 241 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006524198.1 | Gene: | Clic5 / 224796 | MGIID: | 1917912 | Length: | 485 | Species: | Mus musculus |
Alignment Length: | 224 | Identity: | 49/224 - (21%) |
---|---|---|---|
Similarity: | 91/224 - (40%) | Gaps: | 48/224 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 CPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVPALQLVAE-KGEPSLIESLIIAEY 93
Fly 94 LDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFINILVQGTG------------LEDYWTALD 146
Fly 147 IFEEEL------TKRGT--PYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFP-KITK 202
Fly 203 WIALLK-------------ADSVVQSFYA 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstO3 | NP_648234.1 | Thioredoxin_like | 3..95 | CDD:294274 | 17/65 (26%) |
GstA | 22..209 | CDD:223698 | 44/213 (21%) | ||
GST_C_Omega | 109..230 | CDD:198293 | 27/144 (19%) | ||
Clic5 | XP_006524198.1 | O-ClC | 248..483 | CDD:129941 | 49/224 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |