DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and Clic5

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:224 Identity:49/224 - (21%)
Similarity:91/224 - (40%) Gaps:48/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVPALQLVAE-KGEPSLIESLIIAEY 93
            ||::||..::|..|.|.::...::|..||..|..::|....|.|....: |.:.:.||..:....
Mouse   266 CPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETL 330

  Fly    94 LDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFINILVQGTG------------LEDYWTALD 146
            ..:|||:  |..|   .|..:...::.||..::...|...|...            |:||..:  
Mouse   331 TPEKYPK--LAAK---HRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALRKLDDYLNS-- 388

  Fly   147 IFEEEL------TKRGT--PYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFP-KITK 202
            ...||:      .::|:  .:..|::....|..:.|   :|.|:::..:|..|::   .| ::|.
Mouse   389 PLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLP---KLHVVKIVAKKYRNYD---IPAEMTG 447

  Fly   203 WIALLK-------------ADSVVQSFYA 218
            ....||             |||.::..||
Mouse   448 LWRYLKNAYARDEFTNTCAADSEIELAYA 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 17/65 (26%)
GstA 22..209 CDD:223698 44/213 (21%)
GST_C_Omega 109..230 CDD:198293 27/144 (19%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 49/224 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.