DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and gsto-1

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_498728.1 Gene:gsto-1 / 183000 WormBaseID:WBGene00016204 Length:250 Species:Caenorhabditis elegans


Alignment Length:266 Identity:82/266 - (30%)
Similarity:128/266 - (48%) Gaps:53/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGKHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL 67
            :.|.:.||..:|.| ..|..|:|:|||||:|:||.|.:.||.:....|.:|:|:|.||.......
 Worm     7 TSKAIRKGDAEPPL-SKGSFRVYNMRFCPWAERAMLYVAAKGIEAEVVNLNVTDKLEWYWTKHYQ 70

  Fly    68 LKVPALQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSA--FIN 130
            .|.||:    |.....:|||..|.|||||.:||..:||.||.::.|.|:|.:|.:::..|  .:.
 Worm    71 GKAPAV----EHNGKVVIESGFIPEYLDDAFPETRILPTDPYEKVQQKLLADRLTAVAHAVPLLF 131

  Fly   131 ILVQGTGLED--YWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFER------------LSV 181
            .:::...|:|  .....::.::........::.|::||:.||:.:|:||:            |..
 Worm   132 AVMRDRTLKDEKQRKVFEVLKQAENLLANDFYAGSQPGYPDYLSFPFFEKIWWSASLDGVVDLPT 196

  Fly   182 IELKLQKEYNFNESRFPKITKWIALLKADSVVQSF-------------YATPEQHNEFWRTRKAG 233
            ||...::||       ||:|||...:.:..||||.             |||   |.|.       
 Worm   197 IEFPGEEEY-------PKLTKWFQKMISSDVVQSVTQSLEHGAAFMNAYAT---HQEL------- 244

  Fly   234 NANYDL 239
              ||||
 Worm   245 --NYDL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 35/91 (38%)
GstA 22..209 CDD:223698 63/202 (31%)
GST_C_Omega 109..230 CDD:198293 34/149 (23%)
gsto-1NP_498728.1 GST_N_Omega 7..94 CDD:239353 35/91 (38%)
GstA 27..229 CDD:223698 66/212 (31%)
GST_C_Omega 108..238 CDD:198293 29/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37971
Inparanoid 1 1.050 141 1.000 Inparanoid score I3065
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm4834
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X130
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.