DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and gsto-3

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_741069.1 Gene:gsto-3 / 175196 WormBaseID:WBGene00019636 Length:309 Species:Caenorhabditis elegans


Alignment Length:235 Identity:85/235 - (36%)
Similarity:126/235 - (53%) Gaps:22/235 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVP 71
            |..||.:|.| ..|..|||||||||||||..:.|..||:|...|.:|....|.|.:..||:.:||
 Worm    85 LHPGSIEPPL-TPGNYRLYSMRFCPYAQRVLIYLAKKNIPVEVVNVNPDRSPNWYLPKSPIGRVP 148

  Fly    72 ALQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFI------- 129
            ||::..:    .:.||.:|.||||:.:|.|.:||:|..::|..|||:||.|.|.:|..       
 Worm   149 ALEINGK----VVWESNVIVEYLDELFPTNTILPRDAYEKAHQKILVERLSPIMNALFEFYGSSN 209

  Fly   130 NILVQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYN-FN 193
            |...|.....:..:||...|..|  |.| ::||.:||:.||::||:.|||.::.:....::. |.
 Worm   210 NPQAQRQNDMNVHSALRNSENLL--RDT-FYGGRQPGYADYLMWPFLERLQLLTMSPNSQFRYFP 271

  Fly   194 ESRFPKITKWIALLKADSVVQSFYATPEQHNEFWRTRKAG 233
            ...:|||..:||.::....|..|.    :|:.|  .:|.|
 Worm   272 GLHYPKIGAYIARMQNQPEVLGFC----KHDFF--LKKTG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 38/87 (44%)
GstA 22..209 CDD:223698 73/194 (38%)
GST_C_Omega 109..230 CDD:198293 38/128 (30%)
gsto-3NP_741069.1 GST_N_Omega 81..168 CDD:239353 38/87 (44%)
GST_C_Omega 182..308 CDD:198293 40/133 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I8399
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37971
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.71939 Normalized mean entropy S4834
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm4834
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.