DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and Gsto1

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:231 Identity:88/231 - (38%)
Similarity:121/231 - (52%) Gaps:18/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGKHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL 67
            |.:.|.|||..|....:|.:|:|||||||:|||..:||.||.:.:..:.|||..||||..|.:||
Mouse     5 SSRSLGKGSAPPGPVPEGQIRVYSMRFCPFAQRTLMVLKAKGIRHEVININLKNKPEWFFEKNPL 69

  Fly    68 LKVPALQLVAEKGEPSLI-ESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFINI 131
            ..||.|    |..:..|: ||:|..||||:.|||..|.|.||.|:|:.|:.||.||.: ...|..
Mouse    70 GLVPVL----ENSQGHLVTESVITCEYLDEAYPEKKLFPDDPYKKARQKMTLESFSKV-PPLIAS 129

  Fly   132 LVQGTGLEDYWTALDIFEEELTK------RGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEY 190
            .|:....||.....:..|.|..|      ....:.||:.|..|||:.||||:||..:|||....:
Mouse   130 FVRSKRKEDSPNLREALENEFKKLEEGMDNYKSFLGGDSPSMVDYLTWPWFQRLEALELKECLAH 194

  Fly   191 NFNESRFPKITKWIALLKADSVVQSFYATPEQHNEF 226
            .      ||:..|:|.::.|.|..|.....:.:.|:
Mouse   195 T------PKLKLWMAAMQQDPVASSHKIDAKTYREY 224

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 42/92 (46%)
GstA 22..209 CDD:223698 77/193 (40%)
GST_C_Omega 109..230 CDD:198293 37/124 (30%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 42/92 (46%)
GstA 26..224 CDD:223698 79/208 (38%)