DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and Gstt2

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:234 Identity:50/234 - (21%)
Similarity:82/234 - (35%) Gaps:88/234 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRLYSMRFCPYAQRAHLVLNAKN-VPYHSVYINLTE---KPEWLVEVSPLLKVPALQ---LVAEK 79
            |.|| :.......||..:...|| :|:.:..:::.:   ..|...:|:.|.|||.|:   .|..:
Mouse     3 LELY-LDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQFSQVNCLNKVPVLKDGSFVLTE 66

  Fly    80 GEPSLIESLIIAEYLDDKY------------------------PEN---------------PLL- 104
            ...|:|.|..|..||..||                        .:|               ||: 
Mouse    67 SPSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADNIRGTFGVLLWTKVLGPLIG 131

  Fly   105 ---PKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPG 166
               |::.::|.:|:::|            :|.|   |||.:.           |...:..|.:..
Mouse   132 VQVPQEKVERNRDRMVL------------VLQQ---LEDKFL-----------RDRAFLVGQQVT 170

  Fly   167 FVDYMIWPWFERLSVIEL--KLQKEYNFNESRFPKITKW 203
            ..|.|        |:.||  .:...||..|.| |::|.|
Mouse   171 LADLM--------SLEELMQPVALGYNLFEGR-PQLTAW 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 21/79 (27%)
GstA 22..209 CDD:223698 50/234 (21%)
GST_C_Omega 109..230 CDD:198293 22/97 (23%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 22/82 (27%)
GST_C_Theta 98..223 CDD:198292 26/138 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.