Sequence 1: | NP_648234.1 | Gene: | GstO3 / 38972 | FlyBaseID: | FBgn0035904 | Length: | 241 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011241675.1 | Gene: | Gstt2 / 14872 | MGIID: | 106188 | Length: | 251 | Species: | Mus musculus |
Alignment Length: | 234 | Identity: | 50/234 - (21%) |
---|---|---|---|
Similarity: | 82/234 - (35%) | Gaps: | 88/234 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 LRLYSMRFCPYAQRAHLVLNAKN-VPYHSVYINLTE---KPEWLVEVSPLLKVPALQ---LVAEK 79
Fly 80 GEPSLIESLIIAEYLDDKY------------------------PEN---------------PLL- 104
Fly 105 ---PKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPG 166
Fly 167 FVDYMIWPWFERLSVIEL--KLQKEYNFNESRFPKITKW 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstO3 | NP_648234.1 | Thioredoxin_like | 3..95 | CDD:294274 | 21/79 (27%) |
GstA | 22..209 | CDD:223698 | 50/234 (21%) | ||
GST_C_Omega | 109..230 | CDD:198293 | 22/97 (23%) | ||
Gstt2 | XP_011241675.1 | GST_N_Theta | 3..85 | CDD:239348 | 22/82 (27%) |
GST_C_Theta | 98..223 | CDD:198292 | 26/138 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844520 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |