DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and C02D5.4

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001254962.1 Gene:C02D5.4 / 13190517 WormBaseID:WBGene00043097 Length:254 Species:Caenorhabditis elegans


Alignment Length:249 Identity:88/249 - (35%)
Similarity:137/249 - (55%) Gaps:18/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGKHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL 67
            :.|.:..|.|.|..|..|.:|:|:|||||:||||.:..:.||:|...:.::|.|||:|.......
 Worm     8 NSKIVKNGDPAPAPPAAGTIRIYNMRFCPWAQRALIYASVKNIPSDVINVHLQEKPDWYFSKHYK 72

  Fly    68 LKVPALQLVAEKGEPSLIESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFS-SITSAFINI 131
            .:||.|:  .::|:..:|||.:|.|||||.|||..:||.||.::.|.|:||:|.| .::.||..:
 Worm    73 GQVPTLE--HDEGKKHVIESAVIPEYLDDIYPETRILPTDPYEKVQQKLLLDRISGQVSPAFYGV 135

  Fly   132 L--VQGTGLE-----DYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERL-----SVIEL 184
            :  |:...|.     |...|.|..|:.||  |..|.|.:|||||||:::|..:|.     .|.:.
 Worm   136 VQAVKNPDLREEKFADIKKAYDNAEQLLT--GDFYSGTSKPGFVDYLLYPNIQRAYWAAHIVPDF 198

  Fly   185 KLQKEYNFNESRFPKITKWIALLKADSVVQSFYATPEQHNEFWRTRKAGNANYD 238
            .|:.| :|....:|:::||...|::...|.:.....|....|::....|:.|||
 Worm   199 PLEAE-SFPGPNYPRLSKWYKALESIPEVAAASQPTENGVGFFKDYLGGSPNYD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 35/91 (38%)
GstA 22..209 CDD:223698 75/199 (38%)
GST_C_Omega 109..230 CDD:198293 39/133 (29%)
C02D5.4NP_001254962.1 Thioredoxin_like 8..98 CDD:294274 35/91 (38%)
GstA 29..229 CDD:223698 75/204 (37%)
GST_C_family 112..243 CDD:295467 39/133 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159278
Domainoid 1 1.000 71 1.000 Domainoid score I6144
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37971
Inparanoid 1 1.050 141 1.000 Inparanoid score I3065
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm4834
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.