DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and CLIC2

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:229 Identity:53/229 - (23%)
Similarity:91/229 - (39%) Gaps:58/229 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVPALQLVAE------KGEPSLIESL 88
            ||:.||..::|..|.|.::...:::|.|||.|.:::|....|.|....|      |.|..|.::|
Human    30 CPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTL 94

  Fly    89 IIAEY--LDDKYPEN-----------PLLPKDPLKRAQ---DKILLERFSSITSAFINILVQGTG 137
            ....|  |..||.|:           ....|:..|.|.   :|.||:.|..              
Human    95 APPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKR-------------- 145

  Fly   138 LEDYW-TAL------DIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFN-E 194
            |:||. |.|      |..||....|.. :..|::....|..:.|   :|::|::..:|..:|: .
Human   146 LDDYLNTPLLDEIDPDSAEEPPVSRRL-FLDGDQLTLADCSLLP---KLNIIKVAAKKYRDFDIP 206

  Fly   195 SRFPKITKWIALLKA----------DSVVQSFYA 218
            :.|..:.:::....|          |..:::.||
Human   207 AEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 21/72 (29%)
GstA 22..209 CDD:223698 49/208 (24%)
GST_C_Omega 109..230 CDD:198293 27/131 (21%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 20/65 (31%)
N-terminal 1..94 19/63 (30%)
O-ClC 12..245 CDD:129941 53/229 (23%)
Joint loop 95..106 2/10 (20%)
C-terminal 107..247 29/152 (19%)
Foot loop 151..171 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.