DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and CLIC1

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001274522.1 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens


Alignment Length:190 Identity:40/190 - (21%)
Similarity:75/190 - (39%) Gaps:43/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPLLKVPALQLVAE-KGEPSLIESLIIAEY 93
            ||::||..:||..|.|.::...::...:.|.:.::.|..::|.|....| ..:.:.||..:.|..
Human    24 CPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVL 88

  Fly    94 LDDKYPE--------------------------NPLLPKDPLKRAQDKILLERFSSITSAFINIL 132
            ...:||:                          ||.| .|.|::...|.|....:.:||. :...
Human    89 CPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPAL-NDNLEKGLLKALKVLDNYLTSP-LPEE 151

  Fly   133 VQGTGLEDYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNF 192
            |..|..||         |.:::|  .:..||:....|..:.|   :|.::::..:|...|
Human   152 VDETSAED---------EGVSQR--KFLDGNELTLADCNLLP---KLHIVQVVCKKYRGF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 16/65 (25%)
GstA 22..209 CDD:223698 40/190 (21%)
GST_C_Omega 109..230 CDD:198293 18/84 (21%)
CLIC1NP_001274522.1 Required for insertion into the membrane 2..90 16/65 (25%)
O-ClC 6..241 CDD:129941 40/190 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.