DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO3 and LOC100498331

DIOPT Version :9

Sequence 1:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_017951203.2 Gene:LOC100498331 / 100498331 -ID:- Length:267 Species:Xenopus tropicalis


Alignment Length:236 Identity:93/236 - (39%)
Similarity:132/236 - (55%) Gaps:22/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGKHLAKGSPKPVLPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVSPL 67
            |.|.||||||.|....||::|.|.|||||:||||.|||.|:.:.|..||:|...||:|..|.||.
 Frog    30 STKSLAKGSPAPGPVPDGLIRAYLMRFCPFAQRAQLVLIAREINYEVVYVNTLNKPDWFFEKSPF 94

  Fly    68 LKVPALQLVAEKGEPSLI-ESLIIAEYLDDKYPENPLLPKDPLKRAQDKILLERFSSITSAFINI 131
            ..|||:    |..|..|| ||||:.:|||:..|...|.|:||.::||.::|||.|..:.:....|
 Frog    95 GLVPAI----ETSEGQLIYESLIVCDYLDEVSPGKKLTPEDPFQKAQQRMLLEHFFKVENLVFKI 155

  Fly   132 L------VQGTGLE-DYWTALDIFEEELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELK--LQ 187
            |      ...:.|: ::...|.:|:|.::|..|||.||:.....|||:||.|||.|:..:|  |:
 Frog   156 LGALKNNADTSALKAEFLKKLILFDEIVSKLNTPYVGGSSVSMADYMMWPIFERFSIFGVKDCLE 220

  Fly   188 KEYNFNESRFPKITKWIALLKADSVVQSFYATPEQHNEFWR 228
            |.        |.:.:|..|:..|..|::.:..||....|::
 Frog   221 KT--------PHLHQWYQLMLQDPAVKATFTKPEVQEGFFK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 48/92 (52%)
GstA 22..209 CDD:223698 77/196 (39%)
GST_C_Omega 109..230 CDD:198293 38/129 (29%)
LOC100498331XP_017951203.2 Thioredoxin_like 30..119 CDD:412351 48/92 (52%)
GST_C_Omega 133..255 CDD:198293 38/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.