DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6765 and lolal

DIOPT Version :9

Sequence 1:NP_001261582.1 Gene:CG6765 / 38971 FlyBaseID:FBgn0035903 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001163186.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster


Alignment Length:133 Identity:39/133 - (29%)
Similarity:66/133 - (49%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ENYHLKWDSHLTYLNSSIATLYKNEKFADVVLYSSYNSSGIPSDIPTVGISAHKFILSASSQFFA 68
            :.:.|||:...|.:.:|...|...:.|.||.|.....:           ..|||.:|||.|.:|.
  Fly     6 QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQT-----------CKAHKMVLSACSPYFK 59

  Fly    69 TMFETAPITNPNGVLYVVLPPDLSHRAIQILVQYMYSGEATVSNDILNEVLRGGEILKIRGLCRT 133
            .:.|..|..:|     :::..|:|:..:|.::::||:||..||.:.|...|:..:.||::||..|
  Fly    60 ALLEENPSKHP-----IIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAET 119

  Fly   134 SSS 136
            .||
  Fly   120 PSS 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6765NP_001261582.1 BTB 24..132 CDD:279045 31/107 (29%)
BTB 53..130 CDD:197585 24/76 (32%)
lolalNP_001163186.1 BTB_POZ_BAB-like 32..115 CDD:349624 28/98 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451903
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.