DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6765 and LOC3290595

DIOPT Version :10

Sequence 1:NP_648233.1 Gene:CG6765 / 38971 FlyBaseID:FBgn0035903 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_061504414.1 Gene:LOC3290595 / 3290595 VectorBaseID:AGAMI1_013978 Length:232 Species:Anopheles gambiae


Alignment Length:75 Identity:23/75 - (30%)
Similarity:39/75 - (52%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ISAHKFILSASSQFFATMFETAPITNPNGVLYVVLPPDLSHRAIQILVQYMYSGEATVSNDILNE 117
            :.|||.:|...|.||.::|...|..:|..::|.|...||     ..||:::|:||.:|..:.|..
Mosquito    46 LRAHKLVLVLGSPFFRSIFNEVPTPHPVVMIYNVKYEDL-----DALVKFLYTGELSVERERLPS 105

  Fly   118 VLRGGEILKI 127
            :|.....|::
Mosquito   106 LLEAARYLQL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6765NP_648233.1 BTB_POZ 53..129 CDD:453885 23/75 (31%)
LOC3290595XP_061504414.1 None

Return to query results.
Submit another query.