DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6765 and CG3726

DIOPT Version :9

Sequence 1:NP_001261582.1 Gene:CG6765 / 38971 FlyBaseID:FBgn0035903 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_001284917.1 Gene:CG3726 / 31525 FlyBaseID:FBgn0029824 Length:682 Species:Drosophila melanogaster


Alignment Length:475 Identity:105/475 - (22%)
Similarity:152/475 - (32%) Gaps:162/475 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAAENYHLKWDSHLTYLNSSIATLYKNEKFADVVLYSSYNSSGIPSDIPTVGISAHKFILSASSQ 65
            |..:.|.|:|..|.:.|.:..:.|.....|.||.|......           |.||:.:|.|.|.
  Fly     1 MLPQQYCLRWKYHHSNLQTMFSQLLDRGCFCDVTLACEGQL-----------IRAHRVVLCACST 54

  Fly    66 FF-ATMFETAPITNPNGVLYVVLPPDLSHRAIQILVQYMYSGEATVSNDILNEVLRGGEILKIRG 129
            || |.:...|...:|     :::..|::...::.|:::||.||..|.:..|..:|:..:.|||:|
  Fly    55 FFDAVLSNYASERDP-----IIIMKDVTFAEVKCLIEFMYKGEINVEHSSLPSLLKTADDLKIKG 114

  Fly   130 LCRTS---SSNGGGSGSVVTTTHHPHSLAGHLHPREASTMYMSNGTRTALPPPP-------PPPQ 184
            |...:   ..:|                                      ||||       .||:
  Fly   115 LAEVTWRDDEDG--------------------------------------PPPPMAAAEFHSPPR 141

  Fly   185 STMSAQLQGDLYASKPGGSTRFALDHHHLSSHHSHLNHHNPQQQFRGLGASVMPKDSPVIIKSPK 249
            |...:..| ||.                       |.|...|||            .|.   :|.
  Fly   142 SLAESYAQ-DLI-----------------------LQHQQQQQQ------------GPA---APP 167

  Fly   250 LAAHTGLLTVASSSKLGISVNKEVAIDPEDKCCFAAPGQLESQSHPPPPTTTTTTVGGGG-GSVG 313
            |..|      :|::.|.....:|...|.|.    .:||........|..|..|...|..| |||.
  Fly   168 LNLH------SSAALLERDRERERERDRER----LSPGMEGVLGRMPVMTPLTGASGSAGVGSVS 222

  Fly   314 G----SGAPPSQPISICTEVGCSSCPLTAGPGADQAETTLRRTEYEEQALRERNEVGLVFERRLR 374
            |    .|..|.:..              .||...:....|             ::...||..|..
  Fly   223 GGTSLEGVAPVEHF--------------LGPKRKRGRPPL-------------DDAYDVFNVRKL 260

  Fly   375 RESACE---RSRDYYE-APHF-EHVVSSRLAATPPPPPQQAPPSHPPTLRHP--------HNFLT 426
            .:.|..   ..|.|.| |.|| |....:..||:...||...||.....|||.        .:..:
  Fly   261 AQYAANLEPAQRAYLETARHFTEEPPLAAHAASMASPPAACPPKQRQRLRHQQQQQQQLLQSESS 325

  Fly   427 IKQEPT---DWSNNPPNASS 443
            .:::|.   ||||..||.|:
  Fly   326 DQEQPAAGQDWSNLEPNGSA 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6765NP_001261582.1 BTB 24..132 CDD:279045 30/108 (28%)
BTB 53..130 CDD:197585 23/77 (30%)
CG3726NP_001284917.1 BTB 21..118 CDD:279045 30/112 (27%)
BTB 32..121 CDD:197585 28/104 (27%)
HTH_psq 587..622 CDD:283007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.