DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6683 and CG11504

DIOPT Version :9

Sequence 1:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster


Alignment Length:178 Identity:40/178 - (22%)
Similarity:64/178 - (35%) Gaps:48/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TRLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRELAK 70
            ||:|::.|.:....:.:   :.:|.|.:.||    .....:..|||..    :|..........:
  Fly   258 TRIIKIQRRDTSSGQED---SYFEEHTQLHP----PPVKRMYYEASPA----SHNTTSILSPALE 311

  Fly    71 EKAGGTGSDWSLLPHLKFLQHHHHPINHRNSGDLSRSTLKSSDEVNDDEDPLQEAMDEQLAVAGA 135
            ..|.||.|  |:|               ..|..::.|.|: ..:||....|.|         |.|
  Fly   312 SSANGTAS--SVL---------------TTSPGITMSNLR-LPKVNTPPKPAQ---------AQA 349

  Fly   136 APAPPTNPAHATPVAQAEKRIEALLEGLGE--ANRIKA--EKRILAYL 179
            .|:||.....:.|.|:.|      ....||  ||.::|  .:.:|..|
  Fly   350 IPSPPPPTIVSLPPARDE------FATYGEYVANEMRAISNREVLVAL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 17/86 (20%)
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510
CytochromB561_N 238..>409 CDD:286826 40/178 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.