DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6683 and CG6276

DIOPT Version :9

Sequence 1:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_650445.3 Gene:CG6276 / 41855 FlyBaseID:FBgn0038316 Length:470 Species:Drosophila melanogaster


Alignment Length:196 Identity:38/196 - (19%)
Similarity:69/196 - (35%) Gaps:38/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RLIELVRANPKLYERELRN---APYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRREL 68
            :|||:|:.:..:|....:.   .||..:      .|..:...|.....|.:::|.:|....|||.
  Fly    32 KLIEIVQRDEAIYNPRHKYYFCRPYVEN------FWREVDLKLEKNPGASLAKWTNLRISFRREY 90

  Fly    69 AKEKAGGTGSDWSLLPHLKFLQHHHHPI---NHRNSGDLSRSTLKSSDEVNDDEDPLQEAMDEQL 130
            ...........||....:.||    ||.   .|:....|......:...:::....:|......:
  Fly    91 TNYLEEKVPPCWSYFDRMFFL----HPYLRKKHQQPKSLDTQVQDALAHLSNLSSRMQRERSVTI 151

  Fly   131 AVAGAAPAPPTNPAHATPVAQAEKRIEALLEGLGEANRIKAEKRILAYLCKCNLRALNDEQIDDI 195
            ..:.:....||..||.:|.||   :::..|:...||..                   |:.::|||
  Fly   152 PGSSSIGGQPTPSAHQSPPAQ---QLDNYLDYFDEAEH-------------------NNSELDDI 194

  Fly   196 V 196
            :
  Fly   195 M 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 19/89 (21%)
CG6276NP_650445.3 MADF 32..116 CDD:214738 21/93 (23%)
BESS 431..465 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009996
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.