DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6683 and CG13204

DIOPT Version :9

Sequence 1:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster


Alignment Length:116 Identity:24/116 - (20%)
Similarity:47/116 - (40%) Gaps:16/116 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRRELAKEKA 73
            ||:|:....:|..  .|..|: :.:...::|:.||..:.....|...:|.:|.....:.|...:.
  Fly    24 IEIVKKYDVVYNN--HNPDYK-NVEVKLKVWTQIADEIGLSVEASKRKWKNLRDSYTKYLRSFRV 85

  Fly    74 GGTGSD----WSLLPHLKFLQHHHHPINHRNSGDLSRSTLKSSDEVNDDED 120
            |...|.    |:...|:.||:....|         .|::...:.:.||::|
  Fly    86 GTKTSKKYQYWAHADHMDFLKPFQGP---------GRNSANGNGKSNDEDD 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 19/88 (22%)
CG13204NP_610678.1 MADF 22..108 CDD:214738 19/86 (22%)
BESS 478..510 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E5JB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.