Sequence 1: | NP_648232.1 | Gene: | CG6683 / 38970 | FlyBaseID: | FBgn0035902 | Length: | 197 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609298.1 | Gene: | brwl / 34275 | FlyBaseID: | FBgn0032130 | Length: | 435 | Species: | Drosophila melanogaster |
Alignment Length: | 221 | Identity: | 45/221 - (20%) |
---|---|---|---|
Similarity: | 73/221 - (33%) | Gaps: | 76/221 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FDTRLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSLNSEASACVSRWNHLVAKQRREL 68
Fly 69 AKEKAGGTGSD-----WSLLPHLKFL-------------------------QH-HHHPI------ 96
Fly 97 ---------------NHRNSGDLSRS------TLKSSDEVNDDEDPLQEAMDEQLAVAGAAPAPP 140
Fly 141 TNPAHATPVAQAEKRIEALLEGLGEA 166 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6683 | NP_648232.1 | MADF | 7..94 | CDD:214738 | 23/117 (20%) |
brwl | NP_609298.1 | MADF | 60..145 | CDD:214738 | 21/91 (23%) |
BESS | 356..389 | CDD:281011 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12243 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |