DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6683 and madf-5

DIOPT Version :9

Sequence 1:NP_648232.1 Gene:CG6683 / 38970 FlyBaseID:FBgn0035902 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_497028.1 Gene:madf-5 / 175118 WormBaseID:WBGene00007242 Length:423 Species:Caenorhabditis elegans


Alignment Length:160 Identity:45/160 - (28%)
Similarity:60/160 - (37%) Gaps:39/160 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FDTRLIELVRANPKLYERELRNAPYEAHKKRHPEIWSSIATSL--NSEASACVSRWNHLVAKQRR 66
            |:.|||..||..|.||....|.:.....::|   :|.|||.::  |..|.....||..|..:.|:
 Worm     7 FNARLINEVRKYPCLYNHSRRGSGDTMERQR---LWESIAKNIDPNCAAEFAKKRWLQLRDRYRK 68

  Fly    67 ELAKEKAGG--TGSDWSLLPHLKFLQHHHHPINHRNSG---DLSRSTLKS--------------- 111
            ||......|  |...|.....|.:|.    |....|.|   |..:.|.||               
 Worm    69 ELKIAIKNGFVTPVRWCYFNQLSWLD----PFLKDNIGQAADEGKKTGKSDSFDEPSGTPFSWFG 129

  Fly   112 -------SDEVNDDE-DPLQEA--MDEQLA 131
                   .||:.||: ||..|:  :|..||
 Worm   130 FPNLNSIKDEMEDDDSDPALESSVLDRLLA 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6683NP_648232.1 MADF 7..94 CDD:214738 27/90 (30%)
madf-5NP_497028.1 MADF 10..98 CDD:214738 28/94 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E5JB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.