DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment L1CAM and robo1

DIOPT Version :10

Sequence 1:NP_000416.1 Gene:L1CAM / 3897 HGNCID:6470 Length:1257 Species:Homo sapiens
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:1031 Identity:246/1031 - (23%)
Similarity:387/1031 - (37%) Gaps:257/1031 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     9 WPLL-LCSPCLLIQIPEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWTRD 72
            |.|| |.:...|..:..:|:...::|       .|..|||...:..:|.|:..||||....|.:|
  Fly    35 WLLLVLVASNGLPAVRGQYQSPRIIE-------HPTDLVVKKNEPATLNCKVEGKPEPTIEWFKD 92

Human    73 GVHFKPKEELGVTVYQSPHSGSF---TITGNNSNFAQRFQGIYRCFASNKLGTAMSH----EIRL 130
            |......|:....| |......|   |:.|..    ::..|.|.|.|.|::|.|:|.    :|.:
  Fly    93 GEPVSTNEKKSHRV-QFKDGALFFYRTMQGKK----EQDGGEYWCVAKNRVGQAVSRHASLQIAV 152

Human   131 MAEGAPKWPKETVKPVEVEEGESVVLPCNPPPSAEPLRIYWMNS-------KILHIKQDERVTMG 188
            :.:.....||:|    .|.:||:.:|.|.||.......:.|:..       |.:......||.:.
  Fly   153 LRDDFRVEPKDT----RVAKGETALLECGPPKGIPEPTLIWIKDGVPLDDLKAMSFGASSRVRIV 213

Human   189 QNGNLYFANVLTSDNHSDYICHAHFPGTRTIIQKEPIDLRVKATNSMIDRKPRLLFPTNSSSHLV 253
            ..|||..:||                        |||                            
  Fly   214 DGGNLLISNV------------------------EPI---------------------------- 226

Human   254 ALQGQPLVLECIAEGFPTPTIKWLRPSGPMPADRVTYQNHNKTLQLLKVGEEDDGEYRCLAENSL 318
                                                                |:|.|:|:|:|.:
  Fly   227 ----------------------------------------------------DEGNYKCIAQNLV 239

Human   319 GSARHAY-YVTVEAAPYWLHKPQSHLYGPGETARLDCQVQGRPQPEVTWR--INGIPVE--ELAK 378
            |:...:| .:.|:..||::.:|:..:...|:||...|.|.|.|.|:|.|:  ...|||.  .:..
  Fly   240 GTRESSYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSVGGDPPPKVLWKKEEGNIPVSRARILH 304

Human   379 DQKYRIQRGALILSNVQPSDTMVTQCEARNRHGLLLANAYIYVVQLPAKILTADNQTYMAVQGST 443
            |:|      :|.:||:.|:|.....|||.|..|.:.|.|.: :|..|.......:...:.:.| .
  Fly   305 DEK------SLEISNITPTDEGTYVCEAHNNVGQISARASL-IVHAPPNFTKRPSNKKVGLNG-V 361

Human   444 AYLLCKAFGAPVPSVQWLDEDGTTVLQDERFFP---------YANGTLGIRDLQANDTGRYFCLA 499
            ..|.|.|.|.|.|||.|..|..:|::     ||         .|:|||.|.|::..|.|.|.|.|
  Fly   362 VQLPCMASGNPPPSVFWTKEGVSTLM-----FPNSSHGRQHVAADGTLQITDVRQEDEGYYVCSA 421

Human   500 ANDQNNVTIMANLKVKDATQ-----ITQGPRSTIEKKGSRVTFTCQASFDPSLQPSITWRGDGRD 559
            .:..::.|:...|:|....:     |..||.:....|||..|..|:|:.:||  |.|.|..||..
  Fly   422 FSVVDSSTVRVFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRATGNPS--PRIKWFHDGHA 484

Human   560 LQELGDSDKY-FIEDGRLVIHSLDYSDQGNYSCVASTELDVVESRAQLLVVGSPG---------- 613
            :|.   .::| .|:...|.:..|..||.|.|:|.||.|.... |.|..|.|..||          
  Fly   485 VQA---GNRYSIIQGSSLRVDDLQLSDSGTYTCTASGERGET-SWAATLTVEKPGSTSLHRAADP 545

Human   614 ---PVPRLVLSDLHLLTQSQVRVSWSPAEDHN---APIEKYDIEFEDKEMAPEKWYSLGKVPGNQ 672
               |.|......|: ::::.:.:.|:.:::..   .||..|.:|:...:: ...|....:..|:.
  Fly   546 STYPAPPGTPKVLN-VSRTSISLRWAKSQEKPGAVGPIIGYTVEYFSPDL-QTGWIVAAQRVGDT 608

Human   673 TSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEA---APEKNPVDVKGEGNETTNMVIT 734
            ..|...|:|...|.|.|.|.|..|...||.:|.|:.|.||   |...|.:       .....::|
  Fly   609 QVTISGLTPGTSYVFLVRAENTQGISVPSGLSNTIKTIEADFDAASANDL-------SAARTLLT 666

Human   735 WKPLRWMDWNAPQVQ-YRVQWR---------PQGTRGPWQEQIV-------------SDPFLVVS 776
            .|.:..:|.:|.... .|::|.         .:|.|..:::..|             |....||.
  Fly   667 GKSVELIDASAINASAVRLEWMLHVSADEKYVEGLRIHYKDASVPSAQYHSITVMDASAESFVVG 731

Human   777 NTSTFVPYEIKV----QAVNSQGKGPEPQVTIGYSGEDYPQAIPELEGIEILNSSAVLVKWRPVD 837
            |...:..||..:    :.:..|....:..:|.    ||.|.|.|:...|.:.|.:|..|:|.|..
  Fly   732 NLKKYTKYEFFLTPFFETIEGQPSNSKTALTY----EDVPSAPPDNIQIGMYNQTAGWVRWTPPP 792

Human   838 LAQVKGHLRGYNVTYWREGSQRKHSKRHIHKDHVVVPANTTSVILSGLRPYSSYHLEVQAFNGRG 902
            .....|:|.||.:......:.:..:       ::.:.|.||||:|:.|...:.|.:.:.:|...|
  Fly   793 SQHHNGNLYGYKIEVSAGNTMKVLA-------NMTLNATTTSVLLNNLTTGAVYSVRLNSFTKAG 850

Human   903 SGPASE--FTFSTPEGVPGHPEALHLECQSNTSLLLRWQPPLSHNGVLTGYVLSYH 956
            .||.|:  ..|..|.. ..||...|              |..:|:|...|..|:||
  Fly   851 DGPYSKPISLFMDPTH-HVHPPRAH--------------PSGTHDGRHEGQDLTYH 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
L1CAMNP_000416.1 Ig 35..130 CDD:472250 28/101 (28%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 93..97 CDD:409353 1/6 (17%)
Ig strand F 111..116 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/6 (17%)
IgI_2_L1-CAM_like 140..230 CDD:409432 21/96 (22%)
Ig strand A 140..143 CDD:409432 1/2 (50%)
Ig strand A' 145..149 CDD:409432 0/3 (0%)
Ig strand B 152..160 CDD:409432 3/7 (43%)
Ig strand C 167..173 CDD:409432 1/5 (20%)
Ig strand C' 176..179 CDD:409432 0/2 (0%)
Ig strand D 185..189 CDD:409432 1/3 (33%)
Ig strand E 191..195 CDD:409432 3/3 (100%)
Ig strand F 206..214 CDD:409432 0/7 (0%)
Ig strand G 217..230 CDD:409432 3/12 (25%)
Ig3_L1-CAM 248..330 CDD:409460 8/82 (10%)
Ig strand B 260..264 CDD:409460 0/3 (0%)
Ig strand C 273..277 CDD:409460 0/3 (0%)
Ig strand E 295..299 CDD:409460 0/3 (0%)
Ig strand F 309..314 CDD:409460 2/4 (50%)
Ig strand G 322..325 CDD:409460 0/2 (0%)
Ig4_L1-CAM_like 334..422 CDD:409453 29/91 (32%)
Ig strand B 350..354 CDD:409453 1/3 (33%)
Ig strand C 363..367 CDD:409453 1/3 (33%)
Ig strand E 387..391 CDD:409453 1/3 (33%)
Ig strand F 401..406 CDD:409453 1/4 (25%)
Ig strand G 414..417 CDD:409453 1/2 (50%)
Ig 428..514 CDD:472250 27/94 (29%)
Ig strand B 444..448 CDD:409353 1/3 (33%)
Ig strand C 457..461 CDD:409353 2/3 (67%)
Ig strand E 480..484 CDD:409353 3/3 (100%)
Ig strand F 494..499 CDD:409353 2/4 (50%)
Ig strand G 507..510 CDD:409353 1/2 (50%)
Ig_3 519..594 CDD:464046 26/80 (33%)
Cell attachment site. /evidence=ECO:0000255 554..556 0/1 (0%)
FN3 612..709 CDD:238020 25/112 (22%)
FN3 <627..>837 CDD:442628 53/242 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 698..725 9/29 (31%)
fn3 824..907 CDD:394996 21/82 (26%)
FN3 918..1003 CDD:238020 10/39 (26%)
Bravo_FIGEY 1144..1233 CDD:464016
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1176..1207
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1226..1257
robo1NP_476899.1 Ig 56..151 CDD:472250 28/106 (26%)
Ig strand B 73..77 CDD:409353 1/3 (33%)
Ig strand C 86..90 CDD:409353 0/3 (0%)
Ig strand E 111..115 CDD:409353 0/3 (0%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig strand G 143..146 CDD:409353 1/2 (50%)
IgI_2_Robo 158..251 CDD:409389 30/200 (15%)
Ig strand A 158..161 CDD:409389 0/2 (0%)
Ig strand A' 163..167 CDD:409389 1/7 (14%)
Ig strand B 171..178 CDD:409389 2/6 (33%)
Ig strand C 186..191 CDD:409389 1/4 (25%)
Ig strand C' 193..196 CDD:409389 0/2 (0%)
Ig strand D 209..213 CDD:409389 2/3 (67%)
Ig strand E 216..222 CDD:409389 3/5 (60%)
Ig strand F 229..237 CDD:409389 4/7 (57%)
Ig strand G 240..251 CDD:409389 2/10 (20%)
IgI_3_Robo 258..341 CDD:409390 28/89 (31%)
Ig strand A 258..261 CDD:409390 0/2 (0%)
Ig strand A' 263..267 CDD:409390 0/3 (0%)
Ig strand B 270..279 CDD:409390 3/8 (38%)
Ig strand C 285..290 CDD:409390 2/4 (50%)
Ig strand C' 293..296 CDD:409390 0/2 (0%)
Ig strand D 299..304 CDD:409390 0/4 (0%)
Ig strand E 305..313 CDD:409390 3/13 (23%)
Ig strand F 320..328 CDD:409390 3/7 (43%)
Ig strand G 331..341 CDD:409390 3/10 (30%)
Ig 346..437 CDD:472250 27/96 (28%)
Ig strand B 362..366 CDD:409353 1/3 (33%)
Ig strand C 375..379 CDD:409353 2/3 (67%)
Ig strand E 402..406 CDD:409353 3/3 (100%)
Ig strand F 416..421 CDD:409353 2/4 (50%)
Ig strand G 429..432 CDD:409353 1/2 (50%)
Ig 446..531 CDD:472250 32/90 (36%)
Ig strand B 462..466 CDD:409544 1/3 (33%)
Ig strand C 475..479 CDD:409544 1/3 (33%)
Ig strand E 497..501 CDD:409544 1/3 (33%)
FN3 507..>916 CDD:442628 99/421 (24%)
Ig strand F 511..516 CDD:409544 2/4 (50%)
Ig strand G 524..527 CDD:409544 1/2 (50%)
FN3 549..637 CDD:238020 19/89 (21%)
fn3 770..855 CDD:394996 23/91 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.