DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment L1CAM and Dscam4

DIOPT Version :10

Sequence 1:NP_000416.1 Gene:L1CAM / 3897 HGNCID:6470 Length:1257 Species:Homo sapiens
Sequence 2:NP_001261571.1 Gene:Dscam4 / 2769008 FlyBaseID:FBgn0263219 Length:1935 Species:Drosophila melanogaster


Alignment Length:1516 Identity:333/1516 - (21%)
Similarity:528/1516 - (34%) Gaps:499/1516 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    32 MEPPVITEQSPRRLVVFPTDDISLKCEASGKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGS-- 94
            ::.|:...:.|.|:.........::|...|.|..:..||    ...|::::   |:|. .:||  
  Fly    29 LQGPIFLHEPPHRVEFSNNSGGLIECSGHGSPPPEVEWT----PIPPQQDM---VFQL-SNGSMM 85

Human    95 ---FTITGNNSNFAQRFQ-----GIYRCFASNKLGTAMSHEIRLMAEGAPKWPKETVKPVEVEEG 151
               ||        |::::     .:|||...|.:||.:|.|:.:......|:..: |....|..|
  Fly    86 FYPFT--------AEKYRHEVHATVYRCKLRNLVGTVLSREVHVRGVVNQKYAVQ-VHDEYVMTG 141

Human   152 ESVVLPCNPPP--SAEPLRIYWMNSKILHIKQDE----RVTMGQNGNLYFANVLTSDNHSDYICH 210
            .:.||.|..|.  |...|...|:....:|:..:.    :.|:..||.||..|...:|.:..|.|.
  Fly   142 NTAVLKCQVPSYMSEFVLVTAWVQDTGMHLYPNTDIGGKYTVLSNGELYINNAGPNDAYKSYTCR 206

Human   211 -----------AHFPGTRTIIQKEPIDLRVKATNSMIDRKPRLLFPTNSSSHLVALQGQPLVLEC 264
                       :.:||  .||..||        ..|:  :||:....:|..|:| |.|| ..|.|
  Fly   207 TVNRLTGEVQISTYPG--RIIVTEP--------KGMV--QPRINVEKHSMRHVV-LNGQ-TTLPC 257

Human   265 IAEGFPTPTIKWLRPSG----PMP-ADRVTYQNHNKTLQLLKVGEEDDGEYRCLAENSLGSARHA 324
            ||:|.|.||.:|.:...    |:. ::|:|..:.. .|::.|...||.|:|.|...|:.|.....
  Fly   258 IAQGHPVPTYRWFKEENEQLLPLQLSERITIVSAG-LLKITKARLEDSGKYLCWVNNTAGEETIQ 321

Human   325 YYVTVEA------------------APY-------------WLH--KP----------------- 339
            ..:||.|                  |.:             |||  ||                 
  Fly   322 VSLTVTAPLTAHLQPQVQTVDVDKDAQFQCIVSGHPVHDVNWLHDGKPILRDNRVEILTDPPRLI 386

Human   340 -----------------------QSH------------LY-------GPGETARLDCQVQGRPQP 362
                                   ||.            ||       .||.|..|.|...|.|.|
  Fly   387 IKKVQKEDPGMYQCFVSNEWEQIQSTAELQLGDASPELLYWFSEQTLQPGPTVSLKCVATGNPLP 451

Human   363 EVTWRINGIPVEELAK---DQKYRIQRGALI---LSNVQPSDTMVTQCEARNRHGLLLANAYIYV 421
            :.||.::|.|:.:.::   .|...|....:.   :|||:..|.....|.|:|..|.:..:|.:.:
  Fly   452 QFTWSLDGFPIPDSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNI 516

Human   422 VQLPAKILTADNQTYMAVQGSTAYLLCKAFGAPVPSVQWLDEDGTTVLQDERFFPYANGTLGIRD 486
            ..||   ...:......:.||...:.|...|.|:..:.| :.||.|:..:.|...|.||||.|..
  Fly   517 YGLP---YIREMPKITGISGSDLIVKCPVAGYPIDKIHW-ERDGQTLPINRRQRAYNNGTLIIEQ 577

Human   487 LQ-ANDTGRYFCLAANDQNNVTIMANLKVKDATQITQGPR-------STIEKKGSRVTFTCQASF 543
            || ..|.|.|.|:|.|.|.. |...|:::    |:...|:       :.:.::|.|...:||. .
  Fly   578 LQRLEDAGTYTCMAQNKQKQ-TSRRNVEI----QVLVPPKIMPIQAMTNMLREGMRAAISCQI-L 636

Human   544 DPSLQPSITWRGDGRDLQELGDS-----DKYFIEDGRLVIHSLDYSDQGNYSCVAS----TE--- 596
            :..|..|..|..:|:.|...|:.     |:|   ...|||..:.....|||:|:||    ||   
  Fly   637 EGDLPVSFRWERNGKPLIGTGNEVFRRLDEY---SASLVIEHISSDHSGNYTCIASNVAGTERFT 698

Human   597 ------------LDVVESRAQ-----LLVVGSPG-PVPRL------------------------- 618
                        |:..:|.||     ||...|.| |.|.:                         
  Fly   699 VPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPTITWKKAIGPTPGEYKDFLYEPTVQLF 763

Human   619 ----------------------------------------------------------------- 618
                                                                             
  Fly   764 PNGTIFFKKISKESQGHFLCEAKNNIGSGVSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNV 828

Human   619 --------------------------------VLSD----------------------------- 622
                                            ||.|                             
  Fly   829 QGDNPIDFKWKIQATQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQ 893

Human   623 ----LHLLTQS----------------QVRVSWSPAEDHNAPIEKYDIEFEDKEMAPEKWYSLG- 666
                :.|:.|.                .::::||.....|:|||:|.|.:  |::: :.|.:.. 
  Fly   894 DEMSIQLIVQEVPEQPKNLRINSQQSRSLQLTWSQPFAGNSPIEEYHIYY--KQIS-DIWQNAEH 955

Human   667 -KVPGNQTSTTL-KLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEAAPEKNPVDVKGEGNETT 729
             .:.|.||...: :|.|...|..|::|.||.|..|.|.|.: |.|.|..|...|:.|:.|...:|
  Fly   956 LTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQ-VTTLEEVPSGPPLAVRAEPKSST 1019

Human   730 NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPWQEQI------------VSDPF---LVVSNTS 779
            .:.:||.......||...:.|.|.::...|  |..:::            |...|   .|::|.:
  Fly  1020 EIFVTWDAPERDHWNGILLGYYVGYQMSLT--PEDKEVNPTQGFSFKTVEVRSHFGGETVLANLN 1082

Human   780 TFVPYEIKVQAVNSQGKGPEPQVTIGYSGEDYPQAIPELEGIEILNSSAVLVKWRPVDLAQVKGH 844
            .|..|.:.|||..|||.||..:.....:.||.|.:.||....::|.|:::.:.|.|.|:....|.
  Fly  1083 KFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGK 1147

Human   845 LRGYNVTYWREGSQRKHSKRHIHK-DHVVVPANTTSVILSGLRPYSSYHLEVQAFNGRGSGPASE 908
            ::||.|.|        .|...::: |..||.:....|.:..||.|::|.:.|.|:...|.|..::
  Fly  1148 IKGYKVFY--------ISVDELYETDPEVVKSTNQYVTIENLRKYTNYTVWVLAYTKVGDGMKTK 1204

Human   909 -FTFSTPEGVPGHPEALHLECQSNTSLLLRWQPPLSHNGVLTGYVLSYHPLDEGGKGQLSF-NLR 971
             |...|.|.||..|:|:.....|::.:::.|.||...||.:|||.. |..:.|||:.:.:. .|.
  Fly  1205 PFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTF-YMSMLEGGREEGTHKRLL 1268

Human   972 DPELRTHNLTDLSPHLRYRFQLQATTKEGPGE--------------------------------- 1003
            .|.:..|..........|:|.|.|:||.|.||                                 
  Fly  1269 GPFVEMHETVRTQESATYQFWLTASTKMGEGEKTQVVTVPPNNKVPARIVSFSQRIVTPWKEHLE 1333

Human  1004 ------------AIVREGG---------TMALSG--------ISDFGN----ISATAGEN---YS 1032
                        .|.|:.|         |:|.:|        .||.||    :..|.|::   |:
  Fly  1334 LPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIVYN 1398

Human  1033 VVSWVPKEGQ----CN-FRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFK 1092
            :|..||.|..    .| :...:|.:.:....||:.:....::|.:.:....:||.|:....||..
  Fly  1399 IVVKVPPEAPNLTVINAYTDSLLLEWMDNSHGGSPILGYVINYKRDNGDWEELQVDSKTTSHLLT 1463

Human  1093 ERM--FRHQM---AVKTNGTG 1108
            ...  .|:|:   |....|||
  Fly  1464 NLWCGTRYQLYITAYNKIGTG 1484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
L1CAMNP_000416.1 Ig 35..130 CDD:472250 24/104 (23%)
Ig strand B 53..57 CDD:409353 0/3 (0%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 93..97 CDD:409353 3/8 (38%)
Ig strand F 111..116 CDD:409353 3/4 (75%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
IgI_2_L1-CAM_like 140..230 CDD:409432 26/106 (25%)
Ig strand A 140..143 CDD:409432 0/2 (0%)
Ig strand A' 145..149 CDD:409432 0/3 (0%)
Ig strand B 152..160 CDD:409432 3/7 (43%)
Ig strand C 167..173 CDD:409432 2/5 (40%)
Ig strand C' 176..179 CDD:409432 0/2 (0%)
Ig strand D 185..189 CDD:409432 1/3 (33%)
Ig strand E 191..195 CDD:409432 2/3 (67%)
Ig strand F 206..214 CDD:409432 2/18 (11%)
Ig strand G 217..230 CDD:409432 4/12 (33%)
Ig3_L1-CAM 248..330 CDD:409460 28/86 (33%)
Ig strand B 260..264 CDD:409460 1/3 (33%)
Ig strand C 273..277 CDD:409460 1/3 (33%)
Ig strand E 295..299 CDD:409460 1/3 (33%)
Ig strand F 309..314 CDD:409460 2/4 (50%)
Ig strand G 322..325 CDD:409460 0/2 (0%)
Ig4_L1-CAM_like 334..422 CDD:409453 32/167 (19%)
Ig strand B 350..354 CDD:409453 1/3 (33%)
Ig strand C 363..367 CDD:409453 1/3 (33%)
Ig strand E 387..391 CDD:409453 0/6 (0%)
Ig strand F 401..406 CDD:409453 1/4 (25%)
Ig strand G 414..417 CDD:409453 0/2 (0%)
Ig 428..514 CDD:472250 27/86 (31%)
Ig strand B 444..448 CDD:409353 0/3 (0%)
Ig strand C 457..461 CDD:409353 0/3 (0%)
Ig strand E 480..484 CDD:409353 3/3 (100%)
Ig strand F 494..499 CDD:409353 2/4 (50%)
Ig strand G 507..510 CDD:409353 1/2 (50%)
Ig_3 519..594 CDD:464046 21/86 (24%)
Cell attachment site. /evidence=ECO:0000255 554..556 0/1 (0%)
FN3 612..709 CDD:238020 33/271 (12%)
FN3 <627..>837 CDD:442628 64/243 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 698..725 9/26 (35%)
fn3 824..907 CDD:394996 23/83 (28%)
FN3 918..1003 CDD:238020 26/85 (31%)
Bravo_FIGEY 1144..1233 CDD:464016
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1176..1207
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1226..1257
Dscam4NP_001261571.1 Ig 31..124 CDD:472250 24/108 (22%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 63..66 CDD:409353 0/2 (0%)
Ig strand E 82..86 CDD:409353 2/3 (67%)
Ig strand F 102..107 CDD:409353 3/4 (75%)
Ig strand G 115..119 CDD:409353 1/3 (33%)
Ig 235..326 CDD:472250 29/93 (31%)
Ig strand B 253..257 CDD:409353 1/3 (33%)
Ig strand C 266..270 CDD:409353 1/3 (33%)
Ig strand E 292..296 CDD:409353 1/4 (25%)
Ig strand F 306..311 CDD:409353 2/4 (50%)
Ig strand G 319..322 CDD:409353 0/2 (0%)
IgC2_3_Dscam 329..417 CDD:409549 8/87 (9%)
Ig strand A 330..335 CDD:409549 0/4 (0%)
Ig strand A' 338..342 CDD:409549 0/3 (0%)
Ig strand B 345..355 CDD:409549 1/9 (11%)
Ig strand C 360..366 CDD:409549 2/5 (40%)
Ig strand C' 367..370 CDD:409549 1/2 (50%)
Ig strand E 383..389 CDD:409549 0/5 (0%)
Ig strand F 396..404 CDD:409549 0/7 (0%)
Ig strand G 407..417 CDD:409549 2/9 (22%)
IgI_4_Dscam 422..516 CDD:409548 25/93 (27%)
Ig strand A' 430..434 CDD:409548 0/3 (0%)
Ig strand B 437..446 CDD:409548 3/8 (38%)
Ig strand C 451..457 CDD:409548 3/5 (60%)
Ig strand C' 459..462 CDD:409548 1/2 (50%)
Ig strand D 467..475 CDD:409548 1/7 (14%)
Ig strand E 479..488 CDD:409548 0/8 (0%)
Ig strand F 495..503 CDD:409548 2/7 (29%)
Ig strand G 506..516 CDD:409548 2/9 (22%)
IgI_5_Dscam 520..607 CDD:409550 28/95 (29%)
Ig strand A 520..522 CDD:409550 1/4 (25%)
Ig strand A' 527..531 CDD:409550 0/3 (0%)
Ig strand B 534..541 CDD:409550 1/6 (17%)
Ig strand C 548..554 CDD:409550 1/6 (17%)
Ig strand C' 555..557 CDD:409550 1/1 (100%)
Ig strand D 564..568 CDD:409550 1/3 (33%)
Ig strand E 571..577 CDD:409550 4/5 (80%)
Ig strand F 585..593 CDD:409550 4/7 (57%)
Ig strand G 597..607 CDD:409550 2/14 (14%)
Ig 610..703 CDD:472250 24/96 (25%)
Ig strand B 629..633 CDD:409353 0/3 (0%)
Ig strand C 643..647 CDD:409353 1/3 (33%)
Ig strand E 669..673 CDD:409353 1/3 (33%)
Ig strand F 683..688 CDD:409353 3/4 (75%)
Ig strand G 696..699 CDD:409353 0/2 (0%)
IgI_7_Dscam 706..801 CDD:409546 10/94 (11%)
Ig strand A 706..710 CDD:409546 0/3 (0%)
Ig strand A' 715..719 CDD:409546 1/3 (33%)
Ig strand B 722..731 CDD:409546 2/8 (25%)
Ig strand C 737..743 CDD:409546 0/5 (0%)
Ig strand C' 749..752 CDD:409546 0/2 (0%)
Ig strand D 760..763 CDD:409546 0/2 (0%)
Ig strand E 766..772 CDD:409546 0/5 (0%)
Ig strand F 779..787 CDD:409546 0/7 (0%)
Ig strand G 792..801 CDD:409546 0/8 (0%)
Ig 804..889 CDD:472250 3/84 (4%)
Ig strand B 822..826 CDD:409353 0/3 (0%)
Ig strand C 835..839 CDD:409353 0/3 (0%)
FN3 <850..1254 CDD:442628 104/418 (25%)
Ig strand F 882..887 CDD:409353 0/4 (0%)
FN3 906..999 CDD:238020 25/96 (26%)
fn3 1117..1203 CDD:394996 25/93 (27%)
FN3 1185..>1580 CDD:442628 70/301 (23%)
FN3 1405..1494 CDD:238020 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.