DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZC3H3 and CPSF4L

DIOPT Version :9

Sequence 1:NP_648230.1 Gene:ZC3H3 / 38968 FlyBaseID:FBgn0035900 Length:597 Species:Drosophila melanogaster
Sequence 2:XP_011523417.1 Gene:CPSF4L / 642843 HGNCID:33632 Length:190 Species:Homo sapiens


Alignment Length:143 Identity:43/143 - (30%)
Similarity:65/143 - (45%) Gaps:29/143 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 CAIFQKLGKCVAHSRGK-CRKLHDK-RQVAICVSFLRGECTK-PKCLLSHNVTLEKMPVCRYYLR 435
            |..|.| |.|   .:|| |...||: .::.:|..:|||.|.| ..|...|...|.:||.|.:|.:
Human    63 CNFFTK-GLC---EKGKLCPFRHDRGEKMVVCKHWLRGLCKKGDHCKFLHQYDLTRMPECYFYSK 123

  Fly   436 -GVCVREDCPYLHKKLSSKTEICIDFVRGYCPLAAECNKRHEFSCPELERKGKCELPR--CV--- 494
             |.|..::|.:||.|.:.|::.|..:.:|:|.....|..||              :||  |:   
Human   124 FGDCSNKECSFLHVKPAFKSQDCPWYDQGFCKDGPLCKYRH--------------VPRIMCLNYL 174

  Fly   495 --FCKKSPSKRLA 505
              ||.:.|..:.|
Human   175 VGFCPEGPKCQFA 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZC3H3NP_648230.1 YTH1 329..519 CDD:227416 43/143 (30%)
ZnF_C3H1 425..447 CDD:214632 7/22 (32%)
CPSF4LXP_011523417.1 YTH1 34..>182 CDD:227416 41/136 (30%)
ZnF_C3H1 85..108 CDD:214632 7/22 (32%)
ZnF_C3H1 141..166 CDD:214632 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.