DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZC3H3 and zc3h4

DIOPT Version :9

Sequence 1:NP_648230.1 Gene:ZC3H3 / 38968 FlyBaseID:FBgn0035900 Length:597 Species:Drosophila melanogaster
Sequence 2:XP_005157662.1 Gene:zc3h4 / 557823 ZFINID:ZDB-GENE-100330-1 Length:1340 Species:Danio rerio


Alignment Length:219 Identity:54/219 - (24%)
Similarity:76/219 - (34%) Gaps:75/219 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 DKRQVAICVSFLRGECT-KPKCLLSHNVTL-EKMPVCRYYLRGVCVR-EDCPYLHKKLSSKTEIC 457
            :|:..|||..::.|.|| ...|..||::.| :|..:|::|:.|.|.| |:|||:|.....|    
Zfish   361 EKKGKAICKYYIEGRCTWGDHCNFSHDIELPKKKELCKFYITGFCARAENCPYMHGDFPCK---- 421

  Fly   458 IDFVRGYCPLAAECNKRH-------------------------EFSCPELERKGKCELPRCVFCK 497
            :....|.|....||...|                         |....||:::|...||     |
Zfish   422 LFHTTGNCVNGEECMFSHDSLTEDTQELLDKMLAEDAEAGAEDEKEVEELKKQGINPLP-----K 481

  Fly   498 KSPSKRLAKVKSRPKLGSKPVAFTDTAKESSTADELPTSSRYFGSHKEPAEAILTRDDVEQKKPE 562
            ..|...|.....||..|           :|||..|       ||                  .|.
Zfish   482 PPPGVGLLPTPPRPSPG-----------DSSTPME-------FG------------------MPS 510

  Fly   563 AEDEDQKEAGAPCPRRRPQLGTLP 586
            |...:...:|.|.|  .|.:|.:|
Zfish   511 APHGNIPPSGPPAP--GPGVGPVP 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZC3H3NP_648230.1 YTH1 329..519 CDD:227416 40/150 (27%)
ZnF_C3H1 425..447 CDD:214632 10/22 (45%)
zc3h4XP_005157662.1 ZnF_C3H1 366..387 CDD:214632 8/20 (40%)
ZnF_C3H1 393..417 CDD:214632 11/23 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.