DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZC3H3 and Cpsf4

DIOPT Version :9

Sequence 1:NP_648230.1 Gene:ZC3H3 / 38968 FlyBaseID:FBgn0035900 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001361645.1 Gene:Cpsf4 / 54188 MGIID:1861602 Length:269 Species:Mus musculus


Alignment Length:251 Identity:58/251 - (23%)
Similarity:91/251 - (36%) Gaps:65/251 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 VKTNVPCAIFQKLG---------------------KCVAHSRGKCRKLH-DKRQVAICVSFLRGE 410
            :|.::..|:.|:||                     |......|.|...| ...:..:|..:|||.
Mouse    11 IKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGL 75

  Fly   411 CTK-PKCLLSHNVTLEKMPVCRYYLR-GVCVREDCPYLHKKLSSKTEICIDFVRGYCPLAAECNK 473
            |.| .:|...|...:.|||.|.:|.: |.|..::||:||....||.:.|..:.||:|.....|..
Mouse    76 CKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRH 140

  Fly   474 RHEFSCPELERKGKCELPRCVFCKKSPSKRLAKVKSRPKLGSKPVAFTDTAKESSTADELPTSSR 538
            ||       .|:..|......||.:.||.:.    ..|:.                  |||    
Mouse   141 RH-------TRRVICVNYLVGFCPEGPSCKF----MHPRF------------------ELP---- 172

  Fly   539 YFGSHKEPAEAILTRDDVEQ-KKPEAEDEDQ-----KEAGAPCPRRRPQ-LGTLPS 587
             .|:.::|.....|:...:| ..|..:....     .:..:|..:|.|| :|.:.|
Mouse   173 -MGTTEQPPLPQQTQPPTKQSNNPPLQRSSSLIQLTSQNSSPNQQRAPQVIGVMQS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZC3H3NP_648230.1 YTH1 329..519 CDD:227416 44/174 (25%)
ZnF_C3H1 425..447 CDD:214632 9/22 (41%)
Cpsf4NP_001361645.1 YTH1 <25..211 CDD:227416 47/219 (21%)
COG5222 <198..>258 CDD:227547 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.