DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZC3H3 and Zc3h8

DIOPT Version :9

Sequence 1:NP_648230.1 Gene:ZC3H3 / 38968 FlyBaseID:FBgn0035900 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001012090.1 Gene:Zc3h8 / 311414 RGDID:1310458 Length:305 Species:Rattus norvegicus


Alignment Length:342 Identity:71/342 - (20%)
Similarity:116/342 - (33%) Gaps:91/342 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 RSISLTCTPLVKKRRPLREFVGQYALRRTNEAQPNRKLSSKPQALKLGVNKSLSMVSIHGVMYKK 249
            |.:...|.|:.||.:.|           .:...|.:.|..|                      |.
  Rat    45 RKVKRDCEPIPKKFKHL-----------GHAGTPPKSLPRK----------------------KS 76

  Fly   250 ISKNKITKLDASSSARVAKSESPRTLQRTLSGRTLFVSGNKFILDPSGCRLTRVSTSSTGATQSS 314
            .||:.....|..:.::.::....:.||:.:..:.:     ..:..||......|..:.||.||.:
  Rat    77 RSKDYDPYSDGETCSQESEDNFDKELQQYIQAKEM-----ASVAPPSLLPEESVKKAGTGDTQQT 136

  Fly   315 VNRSILRRIDIGGLTYVASPKALNVFVRTSNHVSRAHLITAKQRSLTLLNKSLVKTNVPCAIFQK 379
            ..:.  .:....||..|...|....::.|.|..|.|.|                          |
  Rat   137 AKQK--NKKSKAGLKKVKQKKMKRKWLGTGNKGSNALL--------------------------K 173

  Fly   380 LGKCVAHSRGKCRKLHDKR-QVAICVSFLRGECTKPKCLLSHNVTLEKMPVCRYYLRGVCVRED- 442
            :|    .|:||.....:|: :|.:...|:.          .|.|..:...||:|:|...|::.| 
  Rat   174 IG----GSQGKADGPEEKQPRVRMSQGFIN----------QHTVERKGKQVCKYFLERKCIKGDQ 224

  Fly   443 CPYLH-KKLSSKTEICIDFVRGYCPLAAECNKRH-EFSCPELERKGKC-ELPRCVFCKKSP---- 500
            |.:.| .::..|.|:|..:|:|||.....|...| |:.|.......|| :...|.| ..:|    
  Rat   225 CKFDHDAEIEKKKEMCKYYVQGYCTKGENCLYLHNEYPCKFYHTGTKCYQGDHCNF-SHAPLTAE 288

  Fly   501 -SKRLAKVKSRPKLGSK 516
             .:.||||....|...|
  Rat   289 TQELLAKVLDTDKKSCK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZC3H3NP_648230.1 YTH1 329..519 CDD:227416 47/198 (24%)
ZnF_C3H1 425..447 CDD:214632 7/22 (32%)
Zc3h8NP_001012090.1 ZnF_C3H1 <240..260 CDD:214632 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.