DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZC3H3 and su(sable)

DIOPT Version :9

Sequence 1:NP_648230.1 Gene:ZC3H3 / 38968 FlyBaseID:FBgn0035900 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001284753.1 Gene:su(sable) / 31012 FlyBaseID:FBgn0003575 Length:1325 Species:Drosophila melanogaster


Alignment Length:283 Identity:54/283 - (19%)
Similarity:92/283 - (32%) Gaps:108/283 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 DKRQVAICVSFLRGECTK-PKCLLSHNVTLEKMPVCRYYLRGV-C-VREDCPYLH-KKLSSK--- 453
            :.|::.:|..:|...|.| .||...|    ::.| |:||..|: | ..:||.:.| :.||.:   
  Fly   329 EPRKLELCKFYLMDCCAKRDKCSYMH----KEFP-CKYYYLGMDCYAGDDCLFYHGEPLSEQLRN 388

  Fly   454 ----------TEICIDFVRGYCPLA-AECNKRHEFSCPELERK---------------------- 485
                      .||..||.|....:| .:..:|||..|.:|.|:                      
  Fly   389 VLLKHMETAPKEILGDFKRISRDIAIVQMTRRHEQLCDQLNRENTWNSIGCGLMGKRQDHQMQQQ 453

  Fly   486 --------------------------GKCELPRCVFCKKSPSKRLAKVKSR--PKLGSKPVAFT- 521
                                      |.| :|..:....:|.....|.|||  .|:|:|..|.. 
  Fly   454 QQQLQHQQLQQQQEQQQTQQQAAADGGGC-IPSLLDMVINPPLSENKRKSRWTEKMGAKAAAGAA 517

  Fly   522 -DTAKESSTADELPTSSRY--------------------------------FGSHKEPAEAILTR 553
             .:.::|::.|..|.....                                ||...|....::..
  Fly   518 GSSERDSTSPDAKPLPPHLDLANLSHVLSAENMAKLNKLGITNLEQMLQVPFGQLTEAGLTLVEI 582

  Fly   554 DDVEQKKPEAEDEDQKEAGAPCP 576
            .::::|..:|:.:.|.|..:..|
  Fly   583 GEIQRKAEDAKPQTQAELESSTP 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZC3H3NP_648230.1 YTH1 329..519 CDD:227416 42/190 (22%)
ZnF_C3H1 425..447 CDD:214632 8/23 (35%)
su(sable)NP_001284753.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.