DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZC3H3 and ZC3H4

DIOPT Version :9

Sequence 1:NP_648230.1 Gene:ZC3H3 / 38968 FlyBaseID:FBgn0035900 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_055983.1 Gene:ZC3H4 / 23211 HGNCID:17808 Length:1303 Species:Homo sapiens


Alignment Length:155 Identity:46/155 - (29%)
Similarity:64/155 - (41%) Gaps:29/155 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 GKCVAHSRGKCRKLHDKRQVAICVSFLRGECT-KPKCLLSHNVTL-EKMPVCRYYLRGVCVR-ED 442
            |...:....|..:..||:...||..|:.|.|| ...|..||::.| :|..:|::|:.|.|.| |:
Human   374 GSYRSRDHDKPHQQSDKKGKVICKYFVEGRCTWGDHCNFSHDIELPKKRELCKFYITGFCARAEN 438

  Fly   443 CPYLHK----KLSSKTEICI---DFVRGYCPLA--------------AECNKRHEFSCPELERKG 486
            |||:|.    ||...|..||   |.:..:.||.              ||.....|....||:::|
Human   439 CPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDEKEVEELKKQG 503

  Fly   487 KCELPRCVFCKKSPSKRLAKVKSRP 511
            ...||     |..|...|.....||
Human   504 INPLP-----KPPPGVGLLPTPPRP 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZC3H3NP_648230.1 YTH1 329..519 CDD:227416 46/155 (30%)
ZnF_C3H1 425..447 CDD:214632 10/22 (45%)
ZC3H4NP_055983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..388 2/13 (15%)
ZnF_C3H1 394..415 CDD:214632 8/20 (40%)
ZnF_C3H1 421..445 CDD:214632 11/23 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..571 13/43 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 605..685
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 710..955
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 996..1288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.