DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZC3H3 and cpsf-4

DIOPT Version :9

Sequence 1:NP_648230.1 Gene:ZC3H3 / 38968 FlyBaseID:FBgn0035900 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001023126.1 Gene:cpsf-4 / 178151 WormBaseID:WBGene00044329 Length:302 Species:Caenorhabditis elegans


Alignment Length:287 Identity:68/287 - (23%)
Similarity:98/287 - (34%) Gaps:85/287 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 TNVPCAIFQKLGKCVAHSR-----GK--CRK--------------LH-DKRQVAICVSFLRGECT 412
            |:|..|:|.:.|...|..|     ||  |||              .| |..:..:|..:|||.|.
 Worm    27 TDVEEALFNQRGMKEAPFRDLDRSGKAVCRKNKLKMCPFGPTCPLRHIDGEKAVVCKHWLRGLCK 91

  Fly   413 K-PKCLLSHNVTLEKMPVCRYYLR-GVCVREDCPYLHKKLSSKTEICIDFVRGYCPLAAECNKRH 475
            | .:|...|...|.|||.|.::.: ..|...:||:.|....:|.:.|..:.||:|.....|..||
 Worm    92 KGDQCEFLHEYDLTKMPECFFFSKYSACSNRECPFRHIDPETKMKDCPWYDRGFCRHGPYCKHRH 156

  Fly   476 EFSCPELERKGKCELPRCVFCKKSPSKRLAKVKSRPKLG-----------SKPV---AFT----- 521
                   .|:..|......||.:.|..:.|    .|..|           :||.   |.|     
 Worm   157 -------RRRAVCPNYLAGFCLQGPDCQYA----HPSFGLPSFENIAVSHAKPTYSQAITCHNCH 210

  Fly   522 DTAKESSTADELPTSSRYFGSHKEPAEAILTRD-----DVEQKK--------------------- 560
            :...:::|...||..:|....|....:..|..|     ||...|                     
 Worm   211 ERGHKATTCPHLPGQTRQNQDHHHRVDLSLIPDKKNLSDVTCYKCGEKGHYANRCHKGALAFLSN 275

  Fly   561 -----PEAEDEDQKEAGAPCPRRRPQL 582
                 .|..::|:||.|......||.:
 Worm   276 TAHLAHEQREKDEKEQGRINNMLRPPM 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZC3H3NP_648230.1 YTH1 329..519 CDD:227416 49/186 (26%)
ZnF_C3H1 425..447 CDD:214632 7/22 (32%)
cpsf-4NP_001023126.1 YTH1 <66..187 CDD:227416 35/131 (27%)
ZnF_C3H1 77..102 CDD:214632 8/24 (33%)
ZnF_C3H1 133..158 CDD:214632 8/31 (26%)
ZnF_C3H1 157..181 CDD:214632 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.