| Sequence 1: | NP_001246673.1 | Gene: | CG43163 / 38966 | FlyBaseID: | FBgn0262719 | Length: | 2523 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_014670.1 | Gene: | STI1 / 854192 | SGDID: | S000005553 | Length: | 589 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 467 | Identity: | 94/467 - (20%) |
|---|---|---|---|
| Similarity: | 169/467 - (36%) | Gaps: | 122/467 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 67 EKVRQSNAACQSGDFATAVLLYTDALQL-DPGNHILYSNRSAALLKQGQFTAALQDATQARDLCP 130
Fly 131 QWPKAYFRQGVALQCLGRYGEALAAFASGLAQEPSNKQLMAGLVEASLKSPLRAA---------- 185
Fly 186 LEPTL-----QQLRTMQLQESPFVVSSV---------VGQELL---------------------- 214
Fly 215 --------------------QATQYSAAVTVLEAA--------------LRIGSCSLKLRGSVFS 245
Fly 246 ALSSAHWALNQLDQAIGYMQQDLAVAKSLGDTAGECRAHGNLGSAYFSQGAHKEALTAHRYQLVL 310
Fly 311 AMKCK-DTQAAAAALTSLGHVYTASGD-------YPNALASHKQCVQLFKQLG------------ 355
Fly 356 ----DRLQEAREIGNVGAVYLALGECEAALDCHSQHLRLARKLHDQVEEARAYSNLGSAHHQRRQ 416
Fly 417 FTQAAA-CHEQV 427 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43163 | NP_001246673.1 | TPR_11 | 70..130 | CDD:290150 | 23/60 (38%) |
| TPR repeat | 98..128 | CDD:276809 | 14/29 (48%) | ||
| TPR_11 | 101..164 | CDD:290150 | 24/62 (39%) | ||
| TPR repeat | 133..161 | CDD:276809 | 9/27 (33%) | ||
| TPR repeat | 243..269 | CDD:276809 | 5/25 (20%) | ||
| TPR repeat | 281..311 | CDD:276809 | 4/29 (14%) | ||
| TPR_12 | 282..353 | CDD:290160 | 13/78 (17%) | ||
| TPR_12 | 320..393 | CDD:290160 | 16/95 (17%) | ||
| TPR repeat | 321..349 | CDD:276809 | 7/34 (21%) | ||
| TPR repeat | 354..390 | CDD:276809 | 6/51 (12%) | ||
| TPR_12 | 401..473 | CDD:290160 | 10/28 (36%) | ||
| TPR repeat | 401..429 | CDD:276809 | 10/28 (36%) | ||
| TPR_7 | 403..438 | CDD:289919 | 8/26 (31%) | ||
| TPR repeat | 441..469 | CDD:276809 | |||
| TPR | 467..752 | CDD:223533 | |||
| TPR repeat | 482..509 | CDD:276809 | |||
| TPR repeat | 522..549 | CDD:276809 | |||
| TPR repeat | 561..595 | CDD:276809 | |||
| TPR repeat | 600..630 | CDD:276809 | |||
| TPR repeat | 642..669 | CDD:276809 | |||
| TPR_7 | 643..677 | CDD:289919 | |||
| TPR repeat | 680..716 | CDD:276809 | |||
| TPR repeat | 721..749 | CDD:276809 | |||
| TPR_7 | 723..758 | CDD:289919 | |||
| TPR repeat | 801..829 | CDD:276809 | |||
| TPR_12 | 841..914 | CDD:290160 | |||
| TPR repeat | 841..878 | CDD:276809 | |||
| TPR_12 | 882..949 | CDD:290160 | |||
| TPR repeat | 883..913 | CDD:276809 | |||
| TPR | 884..914 | CDD:197478 | |||
| TPR repeat | 924..949 | CDD:276809 | |||
| TPR_12 | 964..1036 | CDD:290160 | |||
| TPR repeat | 964..998 | CDD:276809 | |||
| TPR repeat | 1004..1032 | CDD:276809 | |||
| TPR repeat | 1043..1073 | CDD:276809 | |||
| TPR_12 | 1044..1112 | CDD:290160 | |||
| TPR_7 | 1046..1078 | CDD:289919 | |||
| TPR_12 | 1081..1153 | CDD:290160 | |||
| TPR repeat | 1081..1109 | CDD:276809 | |||
| CHAT | 1421..1718 | CDD:289536 | |||
| Treacle | <1957..2287 | CDD:281536 | |||
| STI1 | NP_014670.1 | PLN03088 | 5..>106 | CDD:215568 | 36/98 (37%) |
| TPR repeat | 5..33 | CDD:276809 | 10/25 (40%) | ||
| TPR repeat | 39..69 | CDD:276809 | 14/29 (48%) | ||
| TPR repeat | 74..102 | CDD:276809 | 9/27 (33%) | ||
| STI1 | 138..193 | CDD:407696 | 8/54 (15%) | ||
| 3a0801s09 | 203..>573 | CDD:273380 | 43/271 (16%) | ||
| TPR repeat | 262..290 | CDD:276809 | 5/27 (19%) | ||
| TPR repeat | 294..324 | CDD:276809 | 4/36 (11%) | ||
| TPR repeat | 336..363 | CDD:276809 | 5/26 (19%) | ||
| PLN03088 | 396..>549 | CDD:215568 | 18/71 (25%) | ||
| TPR repeat | 396..424 | CDD:276809 | 6/30 (20%) | ||
| TPR repeat | 429..459 | CDD:276809 | 10/29 (34%) | ||
| TPR repeat | 464..490 | CDD:276809 | |||
| STI1 | 527..581 | CDD:407696 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||