DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43163 and SGT2

DIOPT Version :10

Sequence 1:NP_648228.2 Gene:CG43163 / 38966 FlyBaseID:FBgn0262719 Length:2523 Species:Drosophila melanogaster
Sequence 2:NP_014649.1 Gene:SGT2 / 854168 SGDID:S000005533 Length:346 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:61/228 - (26%)
Similarity:97/228 - (42%) Gaps:34/228 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ENNAKIAIVGE---------QLLNKMS------QRDFSENEPECTPELPAANRALFLEKVRQSNA 74
            |..|...|:|:         .:||..|      ::|.:||.....||..|..:|...:...|.|.
Yeast    47 EREAVSGILGKSEFKGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNK 111

  Fly    75 ACQSGDFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQDATQARDLCPQWPKAYFRQ 139
            |..:.|:..|:..||:|:::.|.|.|.|:||:||.....::..|::||..|..:.|.:.:.|.|.
Yeast   112 AMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRL 176

  Fly   140 GVALQCLGRYGEALAAFASGLAQEPSN--KQLMAGLVEASLKSPLRAALEPTL-QQLRTMQLQES 201
            |.|....|:..|||.|:...|..|..|  :.:......|..|......||.|: :|.|...:..|
Yeast   177 GFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDAS 241

  Fly   202 PFV-------VSSVVG---------QELLQATQ 218
            ...       :.|::|         .:|:||.|
Yeast   242 QGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43163NP_648228.2 PEP_TPR_lipo <78..751 CDD:274350 44/160 (28%)
TPR repeat 98..128 CDD:276809 11/29 (38%)
TPR repeat 133..161 CDD:276809 9/27 (33%)
TPR repeat 243..269 CDD:276809
TPR repeat 281..311 CDD:276809
TPR repeat 321..349 CDD:276809
TPR repeat 354..390 CDD:276809
TPR repeat 401..429 CDD:276809
TPR repeat 441..469 CDD:276809
TPR repeat 482..509 CDD:276809
TPR repeat 522..549 CDD:276809
TPR 523..781 CDD:440225
TPR repeat 561..595 CDD:276809
TPR repeat 600..630 CDD:276809
TPR repeat 642..669 CDD:276809
TPR repeat 680..716 CDD:276809
TPR repeat 721..749 CDD:276809
TPR_12 801..865 CDD:315987
TPR repeat 801..829 CDD:276809
Spy 841..>1073 CDD:443119
TPR repeat 841..878 CDD:276809
TPR repeat 883..913 CDD:276809
TPR repeat 924..949 CDD:276809
TPR repeat 964..998 CDD:276809
COG4995 975..1718 CDD:444019
TPR repeat 1004..1032 CDD:276809
TPR repeat 1043..1073 CDD:276809
TPR repeat 1081..1109 CDD:276809
CHAT 1421..1718 CDD:432771
SGT2NP_014649.1 SGTA_dimer 7..71 CDD:465168 5/23 (22%)
NlpI 41..221 CDD:443815 49/173 (28%)
TPR repeat 102..130 CDD:276809 8/27 (30%)
TPR repeat 135..165 CDD:276809 11/29 (38%)
TPR repeat 170..198 CDD:276809 9/27 (33%)
STI1 264..298 CDD:128966 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.