DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43163 and AT3G17670

DIOPT Version :10

Sequence 1:NP_648228.2 Gene:CG43163 / 38966 FlyBaseID:FBgn0262719 Length:2523 Species:Drosophila melanogaster
Sequence 2:NP_001319578.1 Gene:AT3G17670 / 821034 AraportID:AT3G17670 Length:258 Species:Arabidopsis thaliana


Alignment Length:142 Identity:42/142 - (29%)
Similarity:68/142 - (47%) Gaps:25/142 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SNAACQ--SGDFATAVLLYTDALQLDP--GNHILYSNRSAALLKQGQFTAALQDATQARDLCPQW 132
            :||..|  :|:|:.|..|.|.||:|.|  |.|.::.:||.|.|....::.||:|.:||..|.|.:
plant   115 NNALSQIDAGNFSEAEALLTQALELKPYGGLHRIFKHRSVAKLGMLDYSGALEDISQALALAPNY 179

  Fly   133 PKAYFRQGVALQCLGRYGEALAAFASGLAQEPSNKQLMAGLVEASLKSPLRA--------ALE-- 187
            .:.|..||......|:|..|..::.:.|..:||.::          ..|.:.        ||:  
plant   180 SEPYICQGDVYVAKGQYDLAEKSYLTCLEIDPSLRR----------SKPFKVCFVFTLYLALKHR 234

  Fly   188 -PTLQQLRTMQL 198
             |:|.:|.:|.|
plant   235 GPSLLRLASMSL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43163NP_648228.2 PEP_TPR_lipo <78..751 CDD:274350 39/134 (29%)
TPR repeat 98..128 CDD:276809 10/29 (34%)
TPR repeat 133..161 CDD:276809 6/27 (22%)
TPR repeat 243..269 CDD:276809
TPR repeat 281..311 CDD:276809
TPR repeat 321..349 CDD:276809
TPR repeat 354..390 CDD:276809
TPR repeat 401..429 CDD:276809
TPR repeat 441..469 CDD:276809
TPR repeat 482..509 CDD:276809
TPR repeat 522..549 CDD:276809
TPR 523..781 CDD:440225
TPR repeat 561..595 CDD:276809
TPR repeat 600..630 CDD:276809
TPR repeat 642..669 CDD:276809
TPR repeat 680..716 CDD:276809
TPR repeat 721..749 CDD:276809
TPR_12 801..865 CDD:315987
TPR repeat 801..829 CDD:276809
Spy 841..>1073 CDD:443119
TPR repeat 841..878 CDD:276809
TPR repeat 883..913 CDD:276809
TPR repeat 924..949 CDD:276809
TPR repeat 964..998 CDD:276809
COG4995 975..1718 CDD:444019
TPR repeat 1004..1032 CDD:276809
TPR repeat 1043..1073 CDD:276809
TPR repeat 1081..1109 CDD:276809
CHAT 1421..1718 CDD:432771
AT3G17670NP_001319578.1 TRX_Fd_family 21..88 CDD:239278
NlpI 79..>215 CDD:443815 34/99 (34%)
TPR repeat 110..138 CDD:276809 9/22 (41%)
TPR repeat 145..175 CDD:276809 10/29 (34%)
TPR repeat 180..208 CDD:276809 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.