DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43163 and TPR10

DIOPT Version :10

Sequence 1:NP_648228.2 Gene:CG43163 / 38966 FlyBaseID:FBgn0262719 Length:2523 Species:Drosophila melanogaster
Sequence 2:NP_001189808.1 Gene:TPR10 / 819629 AraportID:AT3G04710 Length:680 Species:Arabidopsis thaliana


Alignment Length:164 Identity:57/164 - (34%)
Similarity:76/164 - (46%) Gaps:23/164 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NNHAAGNNENNAKIAIVGEQLLNKMSQRDFSENEPECTPELPAANRALFLEKVRQSNAACQSG-- 79
            :|.....|.|.||....|           ..::.|..:||..|        |..::.|..|..  
plant   519 SNKEQEENSNKAKSQETG-----------IKKDLPVVSPEAKA--------KAAEAKARGQDAFH 564

  Fly    80 --DFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQDATQARDLCPQWPKAYFRQGVA 142
              ||..|:..||.|:..||.:|.|:||||...|:.||...||.||...|:|.|.|||..||:|.|
plant   565 RKDFQMAIDAYTQAIDFDPTDHTLFSNRSLCWLRLGQAEHALSDAKACRELNPDWPKGCFREGAA 629

  Fly   143 LQCLGRYGEALAAFASGLAQEPSNKQLMAGLVEA 176
            |:.|.|:.||..||..|:...|.:|:|:....||
plant   630 LRLLQRFDEAANAFYEGVLLSPESKELIDAFREA 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43163NP_648228.2 PEP_TPR_lipo <78..751 CDD:274350 44/103 (43%)
TPR repeat 98..128 CDD:276809 14/29 (48%)
TPR repeat 133..161 CDD:276809 14/27 (52%)
TPR repeat 243..269 CDD:276809
TPR repeat 281..311 CDD:276809
TPR repeat 321..349 CDD:276809
TPR repeat 354..390 CDD:276809
TPR repeat 401..429 CDD:276809
TPR repeat 441..469 CDD:276809
TPR repeat 482..509 CDD:276809
TPR repeat 522..549 CDD:276809
TPR 523..781 CDD:440225
TPR repeat 561..595 CDD:276809
TPR repeat 600..630 CDD:276809
TPR repeat 642..669 CDD:276809
TPR repeat 680..716 CDD:276809
TPR repeat 721..749 CDD:276809
TPR_12 801..865 CDD:315987
TPR repeat 801..829 CDD:276809
Spy 841..>1073 CDD:443119
TPR repeat 841..878 CDD:276809
TPR repeat 883..913 CDD:276809
TPR repeat 924..949 CDD:276809
TPR repeat 964..998 CDD:276809
COG4995 975..1718 CDD:444019
TPR repeat 1004..1032 CDD:276809
TPR repeat 1043..1073 CDD:276809
TPR repeat 1081..1109 CDD:276809
CHAT 1421..1718 CDD:432771
TPR10NP_001189808.1 DUF1685 82..>125 CDD:462321
ANKYR 232..495 CDD:440430
ANK repeat 282..310 CDD:293786
ANK repeat 313..343 CDD:293786
ANK repeat 345..376 CDD:293786
ANK repeat 378..407 CDD:293786
ANK repeat 410..441 CDD:293786
ANK repeat 442..473 CDD:293786
PLN03088 558..>652 CDD:215568 40/93 (43%)
TPR repeat 585..615 CDD:276809 14/29 (48%)
TPR repeat 620..645 CDD:276809 13/24 (54%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.