Sequence 1: | NP_001246673.1 | Gene: | CG43163 / 38966 | FlyBaseID: | FBgn0262719 | Length: | 2523 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005169572.1 | Gene: | zgc:123010 / 641500 | ZFINID: | ZDB-GENE-051120-15 | Length: | 501 | Species: | Danio rerio |
Alignment Length: | 268 | Identity: | 68/268 - (25%) |
---|---|---|---|
Similarity: | 113/268 - (42%) | Gaps: | 62/268 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 AAGNNENNAKIAIVGEQ----------LLNKMS-----------QRDFSENEPECTPELPAANRA 63
Fly 64 LFLEKVRQSNAA-------CQSGDFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQD 121
Fly 122 ATQARDLCPQWPKAYFRQGVALQCLGRYGEALAAFASGLAQEPSNKQLMAGLVEASLKSPLRAAL 186
Fly 187 EPTLQQL--------RTMQLQESPFVVSSVVGQELLQATQYSAAVTVLEAALRIGSCSLKLRGSV 243
Fly 244 FSALSSAH 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG43163 | NP_001246673.1 | TPR_11 | 70..130 | CDD:290150 | 18/66 (27%) |
TPR repeat | 98..128 | CDD:276809 | 8/29 (28%) | ||
TPR_11 | 101..164 | CDD:290150 | 22/62 (35%) | ||
TPR repeat | 133..161 | CDD:276809 | 12/27 (44%) | ||
TPR repeat | 243..269 | CDD:276809 | 3/9 (33%) | ||
TPR repeat | 281..311 | CDD:276809 | |||
TPR_12 | 282..353 | CDD:290160 | |||
TPR_12 | 320..393 | CDD:290160 | |||
TPR repeat | 321..349 | CDD:276809 | |||
TPR repeat | 354..390 | CDD:276809 | |||
TPR_12 | 401..473 | CDD:290160 | |||
TPR repeat | 401..429 | CDD:276809 | |||
TPR_7 | 403..438 | CDD:289919 | |||
TPR repeat | 441..469 | CDD:276809 | |||
TPR | 467..752 | CDD:223533 | |||
TPR repeat | 482..509 | CDD:276809 | |||
TPR repeat | 522..549 | CDD:276809 | |||
TPR repeat | 561..595 | CDD:276809 | |||
TPR repeat | 600..630 | CDD:276809 | |||
TPR repeat | 642..669 | CDD:276809 | |||
TPR_7 | 643..677 | CDD:289919 | |||
TPR repeat | 680..716 | CDD:276809 | |||
TPR repeat | 721..749 | CDD:276809 | |||
TPR_7 | 723..758 | CDD:289919 | |||
TPR repeat | 801..829 | CDD:276809 | |||
TPR_12 | 841..914 | CDD:290160 | |||
TPR repeat | 841..878 | CDD:276809 | |||
TPR_12 | 882..949 | CDD:290160 | |||
TPR repeat | 883..913 | CDD:276809 | |||
TPR | 884..914 | CDD:197478 | |||
TPR repeat | 924..949 | CDD:276809 | |||
TPR_12 | 964..1036 | CDD:290160 | |||
TPR repeat | 964..998 | CDD:276809 | |||
TPR repeat | 1004..1032 | CDD:276809 | |||
TPR repeat | 1043..1073 | CDD:276809 | |||
TPR_12 | 1044..1112 | CDD:290160 | |||
TPR_7 | 1046..1078 | CDD:289919 | |||
TPR_12 | 1081..1153 | CDD:290160 | |||
TPR repeat | 1081..1109 | CDD:276809 | |||
CHAT | 1421..1718 | CDD:289536 | |||
Treacle | <1957..2287 | CDD:281536 | |||
zgc:123010 | XP_005169572.1 | TPR_11 | 214..276 | CDD:290150 | 17/61 (28%) |
TPR repeat | 214..239 | CDD:276809 | 7/24 (29%) | ||
TPR repeat | 244..274 | CDD:276809 | 8/29 (28%) | ||
TPR_11 | 250..309 | CDD:290150 | 24/70 (34%) | ||
TPR_2 | 279..309 | CDD:285020 | 14/41 (34%) | ||
TPR repeat | 279..307 | CDD:276809 | 14/37 (38%) | ||
TPR_11 | 282..343 | CDD:290150 | 18/72 (25%) | ||
TPR repeat | 313..343 | CDD:276809 | 6/29 (21%) | ||
RRM | <364..>438 | CDD:223796 | 6/21 (29%) | ||
RRM | 370..436 | CDD:214636 | 4/15 (27%) | ||
zf-CCCH | 471..492 | CDD:279036 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |