DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43163 and pins

DIOPT Version :9

Sequence 1:NP_001246673.1 Gene:CG43163 / 38966 FlyBaseID:FBgn0262719 Length:2523 Species:Drosophila melanogaster
Sequence 2:NP_524999.2 Gene:pins / 53569 FlyBaseID:FBgn0040080 Length:658 Species:Drosophila melanogaster


Alignment Length:374 Identity:117/374 - (31%)
Similarity:194/374 - (51%) Gaps:23/374 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 GQELLQATQYSAAVTVLEAALRIGSCSLKLRGSVFSALSSAHWALNQLDQAIGYMQQDLAVAKSL 274
            |:.|.:|....|.|...:||::.|:..|:...:::|.|.:|::.|...::|:.|.:.||.:|||:
  Fly    50 GERLCKAGDCRAGVAFFQAAIQAGTEDLRTLSAIYSQLGNAYFYLGDYNKAMQYHKHDLTLAKSM 114

  Fly   275 GDTAGECRAHGNLGSAYFSQGAHKEALTAHRYQLVLAMKCKDTQAAAAALTSLGHVYTASGDY-- 337
            .|..||.::.||||:.....|...||.......|.||.:..|..:...||.:||:||.|.|.:  
  Fly   115 NDRLGEAKSSGNLGNTLKVMGRFDEAAICCERHLTLARQLGDRLSEGRALYNLGNVYHAKGKHLG 179

  Fly   338 ---------------PNALASHKQCVQLFKQLGDRLQEAREIGNVGAVYLALGECEAALDCHSQH 387
                           ..|:..:::.::|.:.||||..:.|..||:|..|..||:.:||::.|.:.
  Fly   180 QRNPGKFGDDVKEALTRAVEFYQENLKLMRDLGDRGAQGRACGNLGNTYYLLGDFQAAIEHHQER 244

  Fly   388 LRLARKLHDQVEEARAYSNLGSAHHQRRQFTQAAACHEQVLRIAQALGDRSMEAAAYAGLGHAAR 452
            ||:||:..|:..|.||.||||::|....||..||..:::.|.:|..||:|.:||.:...||:...
  Fly   245 LRIAREFGDRAAERRANSNLGNSHIFLGQFEDAAEHYKRTLALAVELGEREVEAQSCYSLGNTYT 309

  Fly   453 CAGDASASKRFHERQLAMALAARDKLGEGRACSNLGIVYQMLGSHDAALKLHQAHLGIARSLGDR 517
            ...:.:.:..:|.|.||:|....|::||.|||.:||..:..:|.|:.|||..:.||.:|:.|.|.
  Fly   310 LLHEFNTAIEYHNRHLAIAQELGDRIGEARACWSLGNAHSAIGGHERALKYAEQHLQLAKELHDP 374

  Fly   518 TGMGKAYGNMARMAHMAGSYEAAVKYHKQELAINQAMNDRSAEAATHGN 566
            .|...|..|::.:..:.|..::.....::|  .....:|.||.    ||
  Fly   375 VGESTARVNISDLRKLLGMPDSEPSPTEEE--ARSTASDHSAS----GN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43163NP_001246673.1 TPR_11 70..130 CDD:290150
TPR repeat 98..128 CDD:276809
TPR_11 101..164 CDD:290150
TPR repeat 133..161 CDD:276809
TPR repeat 243..269 CDD:276809 7/25 (28%)
TPR repeat 281..311 CDD:276809 8/29 (28%)
TPR_12 282..353 CDD:290160 21/87 (24%)
TPR_12 320..393 CDD:290160 27/89 (30%)
TPR repeat 321..349 CDD:276809 9/44 (20%)
TPR repeat 354..390 CDD:276809 15/35 (43%)
TPR_12 401..473 CDD:290160 25/71 (35%)
TPR repeat 401..429 CDD:276809 11/27 (41%)
TPR_7 403..438 CDD:289919 14/34 (41%)
TPR repeat 441..469 CDD:276809 5/27 (19%)
TPR 467..752 CDD:223533 31/100 (31%)
TPR repeat 482..509 CDD:276809 11/26 (42%)
TPR repeat 522..549 CDD:276809 4/26 (15%)
TPR repeat 561..595 CDD:276809 2/6 (33%)
TPR repeat 600..630 CDD:276809
TPR repeat 642..669 CDD:276809
TPR_7 643..677 CDD:289919
TPR repeat 680..716 CDD:276809
TPR repeat 721..749 CDD:276809
TPR_7 723..758 CDD:289919
TPR repeat 801..829 CDD:276809
TPR_12 841..914 CDD:290160
TPR repeat 841..878 CDD:276809
TPR_12 882..949 CDD:290160
TPR repeat 883..913 CDD:276809
TPR 884..914 CDD:197478
TPR repeat 924..949 CDD:276809
TPR_12 964..1036 CDD:290160
TPR repeat 964..998 CDD:276809
TPR repeat 1004..1032 CDD:276809
TPR repeat 1043..1073 CDD:276809
TPR_12 1044..1112 CDD:290160
TPR_7 1046..1078 CDD:289919
TPR_12 1081..1153 CDD:290160
TPR repeat 1081..1109 CDD:276809
CHAT 1421..1718 CDD:289536
Treacle <1957..2287 CDD:281536
pinsNP_524999.2 TPR_12 78..153 CDD:290160 24/74 (32%)
TPR 83..114 CDD:197478 10/30 (33%)
TPR repeat 83..109 CDD:276809 7/25 (28%)
TPR repeat 120..150 CDD:276809 9/29 (31%)
TPR_12 121..203 CDD:290160 20/81 (25%)
TPR_12 162..250 CDD:290160 27/87 (31%)
TPR repeat 162..199 CDD:276809 9/36 (25%)
TPR 219..251 CDD:197478 14/31 (45%)
TPR repeat 219..246 CDD:276809 10/26 (38%)
TPR repeat 251..291 CDD:276809 15/39 (38%)
TPR_12 259..330 CDD:290160 25/70 (36%)
TPR repeat 296..326 CDD:276809 6/29 (21%)
TPR_12 298..370 CDD:290160 24/71 (34%)
TPR 298..330 CDD:197478 8/31 (26%)
TPR repeat 338..366 CDD:276809 11/27 (41%)
GoLoco 468..488 CDD:280368
GoLoco 552..573 CDD:280368
GoLoco 613..633 CDD:280368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321819at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3558
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.