DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43163 and Gpsm2

DIOPT Version :9

Sequence 1:NP_001246673.1 Gene:CG43163 / 38966 FlyBaseID:FBgn0262719 Length:2523 Species:Drosophila melanogaster
Sequence 2:NP_001178891.1 Gene:Gpsm2 / 362021 RGDID:1560967 Length:678 Species:Rattus norvegicus


Alignment Length:562 Identity:151/562 - (26%)
Similarity:250/562 - (44%) Gaps:79/562 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 GQELLQATQYSAAVTVLEAALRIGSCSLKLRGSVFSALSSAHWALNQLDQAIGYMQQDLAVAKSL 274
            |:.|.::....|.|:..|||:::|:..||...:::|.|.:|::.|:...:|:.|...||.:|:::
  Rat    31 GERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTI 95

  Fly   275 GDTAGECRAHGNLGSAYFSQGAHKEALTAHRYQLVLAMKCKDTQAAAAALTSLGHVYTAS----- 334
            ||..||.:|.||||:.....|...||:...:..|.::.:..|....|.||.:||:||.|.     
  Rat    96 GDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFG 160

  Fly   335 -------GDYPN--------ALASHKQCVQLFKQLGDRLQEAREIGNVGAVYLALGECEAALDCH 384
                   |::|.        |:..:::.:.|...||||..:.|..||:|..:..||....|:..|
  Rat   161 CPGPQDVGEFPEEVRLALQAAVELYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAH 225

  Fly   385 SQHLRLARKLHDQVEEARAYSNLGSAHHQRRQFTQAAACHEQVLRIAQALGDRSMEAAAYAGLGH 449
            .|.|.:|::..|:..|.|||||||:|:....:|..|:..:.:.|.:|:.|.||::||.:...||:
  Rat   226 EQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETASEYYRKTLLLARQLKDRAVEAQSCYSLGN 290

  Fly   450 AARCAGDASASKRFHERQLAMALAARDKLGEGRACSNLGIVYQMLGSHDAALKLHQAHLGIARSL 514
            ......|...:..:|.:.||:|...:|::||||||.:||..|..||:||.|:...:.||.|:|.:
  Rat   291 TYTLLQDYEKAIEYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREV 355

  Fly   515 GDRTG--------------MGKAYGN----MARMAHMAGS-YEAAVKYHKQELAINQAMNDRSAE 560
            ||::|              :|.:|..    |:....:.|| :.|..|..::....|..:...:.|
  Rat   356 GDKSGELTARLNLSDLQMVLGLSYSTNNSMMSENIEIDGSLHGAGTKLGRRHSMENMELMKLTPE 420

  Fly   561 AATHGNLAVAYQALGAHDAALTHYRAHLATARSL---KDTAGEAC--ALLNLGNCLSGRQEYEEA 620
            ...:.|..:    |......:....|.|.....|   |..:|.|.  ||.:..|.:..|      
  Rat   421 KVPNWNSEI----LAKQKPCIAKSSAKLLFVNRLKGKKSKSGSASTKALHHASNPIDHR------ 475

  Fly   621 VPHY-----------ESYLMLAQELGDVAAEGKACHLLGYAHFSLGNYRAAVRYY---------- 664
            .||.           |.:..|.:.|.....|.:.|||......|:....|..:..          
  Rat   476 APHAQKKVGSDAVGDEGFFDLLRRLQSSRMEDQRCHLQENRTASVAASSATPKMVKAPSASVVSP 540

  Fly   665 --DQDLALAKDAQHR--PNMGRAYCNLGLAHLALGHTAAALE 702
              |:.|.|...:|.|  .:...::.||....|..|:..:.||
  Rat   541 NTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTEGNNQSVLE 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43163NP_001246673.1 TPR_11 70..130 CDD:290150
TPR repeat 98..128 CDD:276809
TPR_11 101..164 CDD:290150
TPR repeat 133..161 CDD:276809
TPR repeat 243..269 CDD:276809 7/25 (28%)
TPR repeat 281..311 CDD:276809 9/29 (31%)
TPR_12 282..353 CDD:290160 22/90 (24%)
TPR_12 320..393 CDD:290160 27/92 (29%)
TPR repeat 321..349 CDD:276809 11/47 (23%)
TPR repeat 354..390 CDD:276809 14/35 (40%)
TPR_12 401..473 CDD:290160 24/71 (34%)
TPR repeat 401..429 CDD:276809 10/27 (37%)
TPR_7 403..438 CDD:289919 13/34 (38%)
TPR repeat 441..469 CDD:276809 5/27 (19%)
TPR 467..752 CDD:223533 68/285 (24%)
TPR repeat 482..509 CDD:276809 12/26 (46%)
TPR repeat 522..549 CDD:276809 6/31 (19%)
TPR repeat 561..595 CDD:276809 5/36 (14%)
TPR repeat 600..630 CDD:276809 8/42 (19%)
TPR repeat 642..669 CDD:276809 6/38 (16%)
TPR_7 643..677 CDD:289919 9/45 (20%)
TPR repeat 680..716 CDD:276809 6/23 (26%)
TPR repeat 721..749 CDD:276809
TPR_7 723..758 CDD:289919
TPR repeat 801..829 CDD:276809
TPR_12 841..914 CDD:290160
TPR repeat 841..878 CDD:276809
TPR_12 882..949 CDD:290160
TPR repeat 883..913 CDD:276809
TPR 884..914 CDD:197478
TPR repeat 924..949 CDD:276809
TPR_12 964..1036 CDD:290160
TPR repeat 964..998 CDD:276809
TPR repeat 1004..1032 CDD:276809
TPR repeat 1043..1073 CDD:276809
TPR_12 1044..1112 CDD:290160
TPR_7 1046..1078 CDD:289919
TPR_12 1081..1153 CDD:290160
TPR repeat 1081..1109 CDD:276809
CHAT 1421..1718 CDD:289536
Treacle <1957..2287 CDD:281536
Gpsm2NP_001178891.1 TPR <27..286 CDD:223533 79/254 (31%)
TPR repeat 27..52 CDD:276809 7/20 (35%)
TPR repeat 64..90 CDD:276809 7/25 (28%)
TPR repeat 101..131 CDD:276809 10/29 (34%)
TPR repeat 203..230 CDD:276809 9/26 (35%)
TPR_12 243..314 CDD:315987 24/70 (34%)
TPR repeat 243..270 CDD:276809 10/26 (38%)
TPR repeat 281..311 CDD:276809 7/29 (24%)
TPR_12 286..354 CDD:315987 25/67 (37%)
TPR repeat 322..350 CDD:276809 13/27 (48%)
GoLoco 490..512 CDD:214645 5/21 (24%)
GoLoco 543..562 CDD:396661 5/18 (28%)
GoLoco 594..613 CDD:396661
GoLoco 627..649 CDD:214645
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321819at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.