DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43163 and CG31294

DIOPT Version :10

Sequence 1:NP_648228.2 Gene:CG43163 / 38966 FlyBaseID:FBgn0262719 Length:2523 Species:Drosophila melanogaster
Sequence 2:NP_732055.1 Gene:CG31294 / 318666 FlyBaseID:FBgn0051294 Length:225 Species:Drosophila melanogaster


Alignment Length:107 Identity:31/107 - (28%)
Similarity:47/107 - (43%) Gaps:8/107 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RALFLEKVRQSNAACQSGDFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQDATQA- 125
            |.|..|:.|::|       :..||..|:.|:|....:.:||.||:.|.:|:..|..||.|.... 
  Fly   110 RRLGNEEYRRTN-------YEKAVYFYSKAIQYVADSPVLYCNRALAKIKKRDFKLALFDLDYVI 167

  Fly   126 RDLCPQWPKAYFRQGVALQCLGRYGEALAAFASGLAQEPSNK 167
            .:|.|...:|:..:..||..|....|...|.|:......|.|
  Fly   168 FNLDPIHLRAWLYRAGALARLNNESEFEIAIANARLLNRSQK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43163NP_648228.2 PEP_TPR_lipo <78..751 CDD:274350 26/91 (29%)
TPR repeat 98..128 CDD:276809 10/30 (33%)
TPR repeat 133..161 CDD:276809 7/27 (26%)
TPR repeat 243..269 CDD:276809
TPR repeat 281..311 CDD:276809
TPR repeat 321..349 CDD:276809
TPR repeat 354..390 CDD:276809
TPR repeat 401..429 CDD:276809
TPR repeat 441..469 CDD:276809
TPR repeat 482..509 CDD:276809
TPR repeat 522..549 CDD:276809
TPR 523..781 CDD:440225
TPR repeat 561..595 CDD:276809
TPR repeat 600..630 CDD:276809
TPR repeat 642..669 CDD:276809
TPR repeat 680..716 CDD:276809
TPR repeat 721..749 CDD:276809
TPR_12 801..865 CDD:315987
TPR repeat 801..829 CDD:276809
Spy 841..>1073 CDD:443119
TPR repeat 841..878 CDD:276809
TPR repeat 883..913 CDD:276809
TPR repeat 924..949 CDD:276809
TPR repeat 964..998 CDD:276809
COG4995 975..1718 CDD:444019
TPR repeat 1004..1032 CDD:276809
TPR repeat 1043..1073 CDD:276809
TPR repeat 1081..1109 CDD:276809
CHAT 1421..1718 CDD:432771
CG31294NP_732055.1 NlpI <106..>199 CDD:443815 28/95 (29%)
TPR repeat 106..134 CDD:276809 9/30 (30%)
TPR repeat 139..170 CDD:276809 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.