| Sequence 1: | NP_001246673.1 | Gene: | CG43163 / 38966 | FlyBaseID: | FBgn0262719 | Length: | 2523 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001013069.1 | Gene: | Sugt1 / 290408 | RGDID: | 1307550 | Length: | 336 | Species: | Rattus norvegicus |
| Alignment Length: | 283 | Identity: | 56/283 - (19%) |
|---|---|---|---|
| Similarity: | 102/283 - (36%) | Gaps: | 73/283 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 58 PAANRALFLEKVRQSNAACQSGDFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQDA 122
Fly 123 TQARDLCPQWPKAYFRQGVALQCLGRYGEALAAFASGLAQEPSN----------KQLMAGLVEAS 177
Fly 178 LKSPLRAALEPTLQQLRTMQLQ-ESPFVVSSVVGQELLQATQYSAAVTVLEAALRIGS---CSLK 238
Fly 239 LR--------GSVFSAL----------------------------------------SSAHWALN 255
Fly 256 QLDQAIGYMQQDLAVAKSLGDTA 278 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG43163 | NP_001246673.1 | TPR_11 | 70..130 | CDD:290150 | 13/59 (22%) |
| TPR repeat | 98..128 | CDD:276809 | 4/29 (14%) | ||
| TPR_11 | 101..164 | CDD:290150 | 15/62 (24%) | ||
| TPR repeat | 133..161 | CDD:276809 | 9/27 (33%) | ||
| TPR repeat | 243..269 | CDD:276809 | 8/65 (12%) | ||
| TPR repeat | 281..311 | CDD:276809 | |||
| TPR_12 | 282..353 | CDD:290160 | |||
| TPR_12 | 320..393 | CDD:290160 | |||
| TPR repeat | 321..349 | CDD:276809 | |||
| TPR repeat | 354..390 | CDD:276809 | |||
| TPR_12 | 401..473 | CDD:290160 | |||
| TPR repeat | 401..429 | CDD:276809 | |||
| TPR_7 | 403..438 | CDD:289919 | |||
| TPR repeat | 441..469 | CDD:276809 | |||
| TPR | 467..752 | CDD:223533 | |||
| TPR repeat | 482..509 | CDD:276809 | |||
| TPR repeat | 522..549 | CDD:276809 | |||
| TPR repeat | 561..595 | CDD:276809 | |||
| TPR repeat | 600..630 | CDD:276809 | |||
| TPR repeat | 642..669 | CDD:276809 | |||
| TPR_7 | 643..677 | CDD:289919 | |||
| TPR repeat | 680..716 | CDD:276809 | |||
| TPR repeat | 721..749 | CDD:276809 | |||
| TPR_7 | 723..758 | CDD:289919 | |||
| TPR repeat | 801..829 | CDD:276809 | |||
| TPR_12 | 841..914 | CDD:290160 | |||
| TPR repeat | 841..878 | CDD:276809 | |||
| TPR_12 | 882..949 | CDD:290160 | |||
| TPR repeat | 883..913 | CDD:276809 | |||
| TPR | 884..914 | CDD:197478 | |||
| TPR repeat | 924..949 | CDD:276809 | |||
| TPR_12 | 964..1036 | CDD:290160 | |||
| TPR repeat | 964..998 | CDD:276809 | |||
| TPR repeat | 1004..1032 | CDD:276809 | |||
| TPR repeat | 1043..1073 | CDD:276809 | |||
| TPR_12 | 1044..1112 | CDD:290160 | |||
| TPR_7 | 1046..1078 | CDD:289919 | |||
| TPR_12 | 1081..1153 | CDD:290160 | |||
| TPR repeat | 1081..1109 | CDD:276809 | |||
| CHAT | 1421..1718 | CDD:289536 | |||
| Treacle | <1957..2287 | CDD:281536 | |||
| Sugt1 | NP_001013069.1 | TPR 1 | 11..44 | 9/36 (25%) | |
| PLN03088 | 21..336 | CDD:215568 | 53/266 (20%) | ||
| TPR repeat | 44..74 | CDD:276809 | 4/29 (14%) | ||
| TPR 2 | 45..78 | 6/32 (19%) | |||
| TPR | 45..78 | CDD:197478 | 6/32 (19%) | ||
| TPR 3 | 79..112 | 9/32 (28%) | |||
| TPR repeat | 79..107 | CDD:276809 | 9/27 (33%) | ||
| p23_CS_hSgt1_like | 146..229 | CDD:107239 | 16/82 (20%) | ||
| SGS | 256..336 | CDD:282811 | 7/25 (28%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0548 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||