DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6983 and 1700037H04Rik

DIOPT Version :9

Sequence 1:NP_001286984.1 Gene:CG6983 / 38964 FlyBaseID:FBgn0035896 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001298067.1 Gene:1700037H04Rik / 67326 MGIID:1914576 Length:177 Species:Mus musculus


Alignment Length:173 Identity:56/173 - (32%)
Similarity:85/173 - (49%) Gaps:23/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NVEHQDHHVHFDTNTVKDDFESDSCV-TYQRSGDTIVVSLGFLQIRHRYLIELKLPTSLFGDAKT 71
            :.|....|||||...      .||.| ..|.|.::.:|.:|||:|.|||.|...||.        
Mouse    25 DAEGSQSHVHFDEKL------HDSVVMVTQESDNSFLVKVGFLKILHRYEITFTLPP-------- 75

  Fly    72 LASKFEPVISATP--SLHCRITEFEGTKHDEHDFFEMKIEFFAYKEKLLREVLHIVSSSNAKELL 134
             ..:....|..||  |||.::.....|.    :.:.:|.|:.|:||.:|:|.:.:....:....:
Mouse    76 -VRRLSKDIRETPVHSLHLKLLSVTPTS----EGYSIKCEYSAHKEGVLKEEMLLACEGDIGTCV 135

  Fly   135 QLVIAARVLGKGKGTPMLRTGIHCIGVERDDDESEASDFAGFD 177
            ::.:.|||:.:..|||||..|:.|:|.|.:.| ||.||:.|||
Mouse   136 RVTVQARVMDRHHGTPMLLDGVKCVGAELEYD-SEQSDWLGFD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6983NP_001286984.1 DUF4517 14..176 CDD:373468 52/164 (32%)
1700037H04RikNP_001298067.1 DUF4517 31..176 CDD:291667 52/164 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850776
Domainoid 1 1.000 76 1.000 Domainoid score I8962
eggNOG 1 0.900 - - E1_2CAZT
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5202
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48489
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007238
OrthoInspector 1 1.000 - - oto92426
orthoMCL 1 0.900 - - OOG6_109221
Panther 1 1.100 - - LDO PTHR13287
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5624
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.