DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6983 and si:ch211-74f19.2

DIOPT Version :9

Sequence 1:NP_001286984.1 Gene:CG6983 / 38964 FlyBaseID:FBgn0035896 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_689433.5 Gene:si:ch211-74f19.2 / 560941 ZFINID:ZDB-GENE-160114-78 Length:173 Species:Danio rerio


Alignment Length:164 Identity:54/164 - (32%)
Similarity:79/164 - (48%) Gaps:18/164 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 HVHFDTNTVKDDFESDSCV-TYQRSGDTIVVSLGFLQIRHRYLIELKLPTSLFGDAKTLASKFEP 78
            |||||...      .||.| ....|....:|.:|||:.:|||.|...||     :...|.....|
Zfish    27 HVHFDEKL------HDSVVMVIPESKSNFLVKVGFLKTQHRYEIVFTLP-----EVPELGKDVCP 80

  Fly    79 VISATPSLHCRITEFEGTKHDEHDFFEMKIEFFAYKEKLLREVLHIVSSSNAKELLQLVIAARVL 143
              :..|:.|.|||....:....   ..:..|:.|::|.::.|.:.|:|.|.....:::.:.|||:
Zfish    81 --APIPNPHLRITSVTVSSDGG---LRVTCEYMAHQEGVMCEEVQILSESKEDVCVKVKVHARVM 140

  Fly   144 GKGKGTPMLRTGIHCIGVERDDDESEASDFAGFD 177
            .:..|||||..|:.|||.|.:.| ||.||:.|||
Zfish   141 DRHHGTPMLLEGVRCIGAELEYD-SEQSDWQGFD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6983NP_001286984.1 DUF4517 14..176 CDD:373468 51/161 (32%)
si:ch211-74f19.2XP_689433.5 DUF4517 26..172 CDD:291667 51/161 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596799
Domainoid 1 1.000 69 1.000 Domainoid score I9599
eggNOG 1 0.900 - - E1_2CAZT
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5291
OMA 1 1.010 - - QHG48489
OrthoDB 1 1.010 - - D1350523at2759
OrthoFinder 1 1.000 - - FOG0007238
OrthoInspector 1 1.000 - - otm26032
orthoMCL 1 0.900 - - OOG6_109221
Panther 1 1.100 - - LDO PTHR13287
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5624
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.