DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6983 and C20orf27

DIOPT Version :9

Sequence 1:NP_001286984.1 Gene:CG6983 / 38964 FlyBaseID:FBgn0035896 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001034229.1 Gene:C20orf27 / 54976 HGNCID:15873 Length:199 Species:Homo sapiens


Alignment Length:177 Identity:59/177 - (33%)
Similarity:85/177 - (48%) Gaps:31/177 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NVEHQDHHVHFDTNTVKDDFESDSCV-TYQRSGDTIVVSLGFLQIRHRYLIELKLPT--SLFGDA 69
            :.|....|||||...      .||.| ..|.|..:.:|.:|||:|.|||.|...||.  .|..|.
Human    47 DAEGSHSHVHFDEKL------HDSVVMVTQESDSSFLVKVGFLKILHRYEITFTLPPVHRLSKDV 105

  Fly    70 KTLASKFEPVISATPSLHCRITEF----EGTKHDEHDFFEMKIEFFAYKEKLLREVLHIVSSSNA 130
            :.     .||    ||||.::...    ||        :.:|.|:.|:||.:|:|.:.:......
Human   106 RE-----APV----PSLHLKLLSVVPVPEG--------YSVKCEYSAHKEGVLKEEILLACEGGT 153

  Fly   131 KELLQLVIAARVLGKGKGTPMLRTGIHCIGVERDDDESEASDFAGFD 177
            ...:::.:.|||:.:..|||||..|:.|:|.|.:.| ||.||:.|||
Human   154 GTCVRVTVQARVMDRHHGTPMLLDGVKCVGAELEYD-SEHSDWHGFD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6983NP_001286984.1 DUF4517 14..176 CDD:373468 55/168 (33%)
C20orf27NP_001034229.1 DUF4517 53..198 CDD:291667 55/168 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160420
Domainoid 1 1.000 73 1.000 Domainoid score I9279
eggNOG 1 0.900 - - E1_2CAZT
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5264
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48489
OrthoDB 1 1.010 - - D1350523at2759
OrthoFinder 1 1.000 - - FOG0007238
OrthoInspector 1 1.000 - - oto88861
orthoMCL 1 0.900 - - OOG6_109221
Panther 1 1.100 - - LDO PTHR13287
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5624
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.