DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6983 and c20orf27

DIOPT Version :9

Sequence 1:NP_001286984.1 Gene:CG6983 / 38964 FlyBaseID:FBgn0035896 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_031754216.1 Gene:c20orf27 / 493230 XenbaseID:XB-GENE-5956504 Length:179 Species:Xenopus tropicalis


Alignment Length:156 Identity:47/156 - (30%)
Similarity:74/156 - (47%) Gaps:33/156 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EHQDHHVHFDTNTVKDDFESDSCVTYQRSGDTIVVSLGFLQIRHRYLIELKLPTSLFGDAKTLAS 74
            |...:|||||...    .:|...|:.|..|: .:|.:|||:|.|:|.|...||.         ..
 Frog    24 EGAHNHVHFDEQL----HDSVVMVSQQEDGN-FLVKVGFLKILHKYEISFSLPP---------VQ 74

  Fly    75 KFEPVISAT--PSLHCRI----TEFEGTKHDEHDFFEMKIEFFAYKEKLLREVLHIVSSSNAKEL 133
            :....|.|.  |:|:.::    ::.||        ..:|.|:.|:||.:|:|.:.:.|.:|.|..
 Frog    75 RLGKSICAVPLPTLNLKVLSITSQAEG--------HSIKCEYTAHKEGVLKEEMILASETNDKAF 131

  Fly   134 LQLVIAARVLGKG-----KGTPMLRT 154
            :::|:.|||||.|     .||..|.|
 Frog   132 VKVVVQARVLGTGLWKQNTGTEPLPT 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6983NP_001286984.1 DUF4517 14..176 CDD:373468 46/152 (30%)
c20orf27XP_031754216.1 DUF4517 28..>144 CDD:373468 41/137 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8748
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5066
OMA 1 1.010 - - QHG48489
OrthoDB 1 1.010 - - D1350523at2759
OrthoFinder 1 1.000 - - FOG0007238
OrthoInspector 1 1.000 - - oto102730
Panther 1 1.100 - - LDO PTHR13287
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5624
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.110

Return to query results.
Submit another query.