DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6983 and RGD1311739

DIOPT Version :9

Sequence 1:NP_001286984.1 Gene:CG6983 / 38964 FlyBaseID:FBgn0035896 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001020862.1 Gene:RGD1311739 / 311428 RGDID:1311739 Length:174 Species:Rattus norvegicus


Alignment Length:177 Identity:56/177 - (31%)
Similarity:83/177 - (46%) Gaps:31/177 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NVEHQDHHVHFDTNTVKDDFESDSCV-TYQRSGDTIVVSLGFLQIRHRYLIELKLPTSLFGDAKT 71
            :.|....|||||...      .||.| ..|.|.::.:|.:|||:|.|||.|...||.        
  Rat    22 DAEGSQSHVHFDEKL------HDSVVMVTQESDNSFLVKVGFLKILHRYEITFTLPA-------- 72

  Fly    72 LASKFEPVISATP--SLHCRITEF----EGTKHDEHDFFEMKIEFFAYKEKLLREVLHIVSSSNA 130
             ..:....|...|  |||.::...    ||        :.:|.|:.|:||.:|:|.:.:....:.
  Rat    73 -VRRLSKDIREAPVHSLHLKLLSVTPIPEG--------YSIKCEYSAHKEGVLKEEMLLACEGDI 128

  Fly   131 KELLQLVIAARVLGKGKGTPMLRTGIHCIGVERDDDESEASDFAGFD 177
            ...:.:.:.|||:.:..|||||..|:.|:|.|.:.| ||.||:.|||
  Rat   129 GTCVHVTVQARVMDRHHGTPMLLDGVKCVGAELEYD-SEHSDWHGFD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6983NP_001286984.1 DUF4517 14..176 CDD:373468 52/168 (31%)
RGD1311739NP_001020862.1 DUF4517 28..173 CDD:373468 52/168 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354483
Domainoid 1 1.000 71 1.000 Domainoid score I9272
eggNOG 1 0.900 - - E1_2CAZT
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5184
OMA 1 1.010 - - QHG48489
OrthoDB 1 1.010 - - D1350523at2759
OrthoFinder 1 1.000 - - FOG0007238
OrthoInspector 1 1.000 - - oto95991
orthoMCL 1 0.900 - - OOG6_109221
Panther 1 1.100 - - LDO PTHR13287
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.