DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cbl and LONRF1

DIOPT Version :9

Sequence 1:	NP_648224.1	Gene:	Cbl / 38961	FlyBaseID:	FBgn0020224	Length:	878	Species:	Drosophila melanogaster
Sequence 2:	NP_689484.3	Gene:	LONRF1 / 91694	HGNCID:	26302	Length:	773	Species:	Homo sapiens

Alignment Length:	81	Identity:	20/81 - (24%)
Similarity:	30/81 - (37%)	Gaps:	19/81 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   364 STFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKG------------TE 416
            |.|: |.:|.....:....||||..|..||.  :.......||.|:..:|.            .|
Human   475 SDFE-CSLCMRLFFEPVTTPCGHSFCKNCLE--RCLDHAPYCPLCKESLKEYLADRRYCVTQLLE 536

  Fly   417 QIVV----DAFDPRKQ 428
            :::|    |....||:
Human   537 ELIVKYLPDELSERKK 552

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cbl	NP_648224.1	Cbl_N	42..163	CDD:280432
		Cbl_N2	167..250	CDD:280857
		SH2_Cbl-b_TKB	244..340	CDD:198176
		zf-C3HC4_3	367..415	CDD:290631	13/59 (22%)
		UBA_Cbl_like	834..873	CDD:270503
LONRF1	NP_689484.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..29
		TPR 1	48..81
		TPR 2	212..244
		TPR repeat	212..239	CDD:276809
		TPR 3	246..278
		TPR repeat	247..273	CDD:276809
		TPR_16	251..311	CDD:290168
		TPR repeat	278..308	CDD:276809
		TPR 4	279..312
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	359..388
		RING	478..520	CDD:238093	12/44 (27%)
		LON	564..765	CDD:271862
		LON_substr_bdg	567..765	CDD:280370
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910